请输入您要查询的英文单词:

 

单词 shot
释义
Shot
nnoun.actthe act of firing a projectile
Synset:shooting
Examples:
  • his shooting was slow but accurate
Derivationally Related Form:shoot
Hypernyms:actuation propulsion
Inherited Hypernyms:shootingpropulsionacteventpsychological featureabstractionentity
Direct Hyponyms:countershotdischargefiringfiring offgunfiregunshotheadshotpotshotshellfireshoot
Part Meronyms:fire control
Full Hyponyms:
countershotdischargeenfiladegungunfireheadshotpotshotshellfireshootskeetsnipe
nnoun.artifacta solid missile discharged from a firearm
Synset:pellet
Examples:
  • the shot buzzed past his ear
Part Holonyms:canister canister shot case shot
Hypernyms:missile projectile
Inherited Hypernyms:shotprojectileweaponinstrumentdeviceinstrumentalityartifactwholeobjectphysical entityentity
Direct Hyponyms:BBBB shotballbird shotbuckshotduck shotgrapegrapeshotmusket ball
Full Hyponyms:
bbbird shotgrapeshotmusket ball
nnoun.act(sports) the act of swinging or striking at a ball with a club or racket or bat or cue or hand
Topic:athleticssport
Synset:stroke
Examples:
  • it took two strokes to get out of the bunker
  • a good shot requires good balance and tempo
  • he left me an almost impossible shot
Derivationally Related Form:stroke
Hypernyms:maneuver manoeuvre play
Inherited Hypernyms:strokemaneuvermotionchangeactionacteventpsychological featureabstractionentity
Direct Hyponyms:baseball swingbreakcannoncaromcutgolf shotgolf strokemassemasse shotmiscueswingswipetennis shottennis strokeundercut
Part Meronyms:follow-through
Full Hyponyms:
aceapproachbackhandbackhand drivebaseball swingbreakcaromchipchopcutdouble faultdownswingdrivedrop shotexplosionfaultfootfaultforehandforehand drivegetgolf strokeground strokehalf volleyhookletlobmassemiscueoverheadpassing shotpitchputtreturnsclaffserveshanksliceswipeteeofftennis stroketwo-handed backhandvolley
nnoun.statea chance to do something
Domain Usage:colloquialism
Synset:crack
Examples:
  • he wanted a shot at the champion
Hypernyms:chance opportunity
Inherited Hypernyms:shotopportunitypossibilitybeingstateattributeabstractionentity
nnoun.persona person who shoots (usually with respect to their ability to shoot)
Synset:shooter
Examples:
  • he is a crack shot
  • a poor shooter
Derivationally Related Form:shoot
Hypernyms:expert
Inherited Hypernyms:shotexpertpersoncausal agentphysical entityentity
Inherited Hypernyms:shotexpertpersonorganismliving thingwholeobjectphysical entityentity
Direct Hyponyms:crack shotgungunmanmarksmansharpshootertrapshooter
Full Hyponyms:
deadeyefranc-tireurgunmanmarksmanriflemansnipertrapshooter
nnoun.communicationa consecutive series of pictures that constitutes a unit of action in a film
Synset:scene
Part Holonyms:film flick motion-picture show motion picture movie moving-picture show moving picture pic picture picture show
Hypernyms:exposure photo photograph pic picture
Inherited Hypernyms:scenephotographrepresentationcreationartifactwholeobjectphysical entityentity
Direct Hyponyms:outtake
Full Hyponyms:
outtake
nnoun.actthe act of putting a liquid into the body by means of a syringe
Synset:injection
Examples:
  • the nurse gave him a flu shot
Derivationally Related Form:inject
Hypernyms:medical aid medical care
Inherited Hypernyms:injectionmedical caretreatmentcareworkactivityacteventpsychological featureabstractionentity
Direct Hyponyms:intradermal injectionintramuscular injectionintravenous injectionsubcutaneous injection
Full Hyponyms:
fixintradermal injectionintramuscular injectionintravenous injectionsubcutaneous injection
nnoun.quantitya small drink of liquor
Synset:nip
Examples:
  • he poured a shot of whiskey
Hypernyms:small indefinite amount small indefinite quantity
Inherited Hypernyms:nipsmall indefinite quantityindefinite quantitymeasureabstractionentity
nnoun.communicationan aggressive remark directed at a person like a missile and intended to have a telling effect
Synset:barb dig gibe jibe shaft slam
Examples:
  • his parting shot was 'drop dead'
  • she threw shafts of sarcasm
  • she takes a dig at me every chance she gets
Derivationally Related Form:gibe
Hypernyms:comment input remark
Inherited Hypernyms:shotremarkstatementmessagecommunicationabstractionentity
Direct Hyponyms:cheap shot
Full Hyponyms:
cheap shot
nnoun.cognitionan estimate based on little or no information
Synset:dead reckoning guess guessing guesswork
Derivationally Related Form:guess
Hypernyms:approximation estimate estimation idea
Inherited Hypernyms:guessestimatecalculationproblem solvingthinkinghigher cognitive processprocesscognitionpsychological featureabstractionentity
nnoun.artifactan informal photograph; usually made with a small hand-held camera
Synset:snap snapshot
Examples:
  • my snapshots haven't been developed yet
  • he tried to get unposed shots of his friends
Derivationally Related Form:snap
Hypernyms:exposure photo photograph pic picture
Inherited Hypernyms:snapshotphotographrepresentationcreationartifactwholeobjectphysical entityentity
nnoun.artifactsports equipment consisting of a heavy metal ball used in the shot put
Examples:
  • he trained at putting the shot
Hypernyms:sports equipment
Inherited Hypernyms:shotsports equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity
nnoun.artifactan explosive charge used in blasting
Hypernyms:burster bursting charge charge explosive charge
Inherited Hypernyms:shotchargeexplosivechemicalmaterialsubstancematterphysical entityentity
Inherited Hypernyms:shotchargeexplosivechemicalmaterialsubstancepartrelationabstractionentity
nnoun.acta blow hard enough to cause injury
Examples:
  • he is still recovering from a shot to his leg
  • I caught him with a solid shot to the chin
Hypernyms:blow
Inherited Hypernyms:shotblowstrokemotionchangeactionacteventpsychological featureabstractionentity
Direct Hyponyms:cheap shot
Full Hyponyms:
cheap shot
nnoun.actan attempt to score in a game
Hypernyms:attempt effort endeavor endeavour try
Inherited Hypernyms:shotattemptactivityacteventpsychological featureabstractionentity
Direct Hyponyms:basketball shotheadshotslapshot
Full Hyponyms:
bank shotbasketball shotdunkfinger-rollfoul shotheadshothook shotjumperlay-upone-and-onepivot shotscoop shotset shotslam dunkslapshottip in
nnoun.actinformal words for any attempt or effort
Synset:stab
Examples:
  • he gave it his best shot
  • he took a stab at forecasting
Hypernyms:attempt effort endeavor endeavour try
Inherited Hypernyms:shotattemptactivityacteventpsychological featureabstractionentity
nnoun.actthe launching of a missile or spacecraft to a specified destination
Synset:blastoff
Derivationally Related Form:blast off
Hypernyms:rocket firing rocket launching
Inherited Hypernyms:blastoffrocket firinglaunchingpropulsionacteventpsychological featureabstractionentity
vverb.competitionhit with a missile from a weapon
Synset:hit pip shoot
Derivationally Related Form:shootershoothitting
Hypernyms:injure wound
Inherited Hypernyms:shootinjurehurtindisposechange
Direct Hyponyms:grassgun downkneecap
Full Troponyms:grassgun downkneecap
Sentence Frame:Somebody ---s something | Somebody ---s somebody
vverb.socialkill by firing a missile
Synset:pip shoot
Derivationally Related Form:shootershooting
Hypernyms:kill
Inherited Hypernyms:shootkill
Direct Hyponyms:flightpick off
Full Troponyms:flightpick off
Sentence Frame:Somebody ---s somebody | They want to --- the prisoners (apply to: shoot)
vverb.competitionfire a shot
Synset:blast shoot
Examples:
  • the gunman blasted away
Derivationally Related Form:shootershootshooting
Hypernyms:discharge fire
Inherited Hypernyms:blastfire
Direct Hyponyms:blazeblaze awayfiregunopen fireovershootpumpsharpshootsnipe
Full Troponyms:blaze awaygunmachine gunopen fireovershootpumpsharpshoot
Sentence Frame:Somebody ---s something | Somebody ---s | Somebody ---s PP
vverb.communicationmake a film or photograph of something
Topic:filmflickmotion-picture showmotion picturemoviemoving-picture showmoving picturepicpicturepicture show
Synset:film shoot take
Examples:
  • take a scene
  • shoot a movie
Derivationally Related Form:takefilmfilming
Hypernyms:enter put down record
Inherited Hypernyms:filmrecordsavekeephave
Direct Hyponyms:reshoot
Full Troponyms:reshoot
Sentence Frame:Somebody ---s something | Somebody ---s somebody | Somebody ---s (apply to: film) | Sam cannot --- Sue (apply to: take) | Sam and Sue --- the movie (apply to: shoot, film)
vverb.motionsend forth suddenly, intensely, swiftly
Examples:
  • shoot a glance
Hypernyms:cast contrive project throw
Inherited Hypernyms:shootprojectsendmove
Sentence Frame:Somebody ---s something
vverb.motionrun or move very quickly or hastily
Synset:dart dash flash scoot scud shoot
Examples:
  • She dashed into the yard
Derivationally Related Form:dashdartscooter
Hypernyms:belt along bucket along cannonball along hasten hie hotfoot pelt along race rush rush along speed step on it
Inherited Hypernyms:dartrushtravel
Direct Hyponyms:plunge
Full Troponyms:plunge
Sentence Frame:Something is ---ing PP | Somebody ---s PP
vverb.motionmove quickly and violently
Synset:buck charge shoot shoot down tear
Examples:
  • The car tore down the street
  • He came charging into my office
Hypernyms:belt along bucket along cannonball along hasten hie hotfoot pelt along race rush rush along speed step on it
Inherited Hypernyms:tearrushtravel
Direct Hyponyms:rip
Full Troponyms:rip
Sentence Frame:Something is ---ing PP | Somebody ---s PP
vverb.contactthrow or propel in a specific direction or towards a specific objective
Examples:
  • shoot craps
  • shoot a golf ball
Derivationally Related Form:shooter
Hypernyms:hit
Inherited Hypernyms:shoothitpropelmove
Direct Hyponyms:birdiebogeybreakcaromchipdouble birdiedouble bogeydunkeagleknuckle
Full Troponyms:birdiebogeybreakcaromchipdouble bogeydunkeagleknuckleslam-dunk
Sentence Frame:Somebody ---s something | Somebody ---s
vverb.communicationrecord on photographic film
Topic:photographypicture taking
Synset:photograph shoot snap
Examples:
  • I photographed the scene of the accident
  • She snapped a picture of the President
Derivationally Related Form:photographsnapphotographer
Hypernyms:enter put down record
Inherited Hypernyms:photographrecordsavekeephave
Direct Hyponyms:retakex-ray
Full Troponyms:retakex-ray
Sentence Frame:Somebody ---s something | Somebody ---s somebody | Somebody ---s
vverb.weatheremit (as light, flame, or fumes) suddenly and forcefully
Examples:
  • The dragon shot fumes and flames out of its mouth
Hypernyms:emit give off give out
Inherited Hypernyms:shootemit
Sentence Frame:Something ---s something
vverb.perceptioncause a sharp and sudden pain in
Examples:
  • The pain shot up her leg
Hypernyms:ache hurt smart
Inherited Hypernyms:shootachecause to be perceived
Sentence Frame:Something is ---ing PP
vverb.contactforce or drive (a fluid or gas) into by piercing
Synset:inject shoot
Examples:
  • inject hydrogen into the balloon
Derivationally Related Form:injectableinjectorinjection
Hypernyms:enclose inclose insert introduce put in stick in
Inherited Hypernyms:injectinsertputmove
Sentence Frame:Somebody ---s somebody | Somebody ---s somebody with something | They --- a chemical into the fruit (apply to: inject, shoot) | They --- the fruit with a chemical (apply to: inject, shoot)
vverb.contactvariegate by interweaving weft threads of different colors
Examples:
  • shoot cloth
Hypernyms:interweave weave
Inherited Hypernyms:shootweavetwistchange shapechange
Sentence Frame:Somebody ---s something
vverb.contactthrow dice, as in a crap game
Derivationally Related Form:shooter
Hypernyms:throw
Inherited Hypernyms:shootthrowturntransmitmove
Sentence Frame:Somebody ---s
vverb.consumptionspend frivolously and unwisely
Synset:dissipate fool fool away fritter fritter away frivol away shoot
Examples:
  • Fritter away one's inheritance
Derivationally Related Form:dissipation
Hypernyms:consume squander ware waste
Inherited Hypernyms:fritterconsumespendpaygivetransfer
Entailment:consume deplete eat up eat exhaust run through use up wipe out
Sentence Frame:Somebody ---s something
vverb.competitionscore
Topic:athleticssport
Examples:
  • shoot a basket
  • shoot a goal
Hypernyms:hit rack up score tally
Inherited Hypernyms:shootscoregain
Sentence Frame:Somebody ---s something
vverb.communicationutter fast and forcefully
Examples:
  • She shot back an answer
Hypernyms:emit let loose let out utter
Inherited Hypernyms:shootutter
Sentence Frame:Somebody ---s something
vverb.cognitionmeasure the altitude of by using a sextant
Examples:
  • shoot a star
Hypernyms:measure measure out mensurate
Inherited Hypernyms:shootmeasuredecide
Sentence Frame:Somebody ---s something
vverb.changeproduce buds, branches, or germinate
Synset:bourgeon burgeon forth germinate pullulate shoot sprout spud
Examples:
  • the potatoes sprouted
Derivationally Related Form:shootsproutgerminationpullulationgermsprouting
Hypernyms:grow
Inherited Hypernyms:shootgrowdevelopgrowincreasechange magnitudechange
Sentence Frame:Something ---s
vverb.bodygive an injection to
Topic:medicinepractice of medicine
Synset:inject shoot
Examples:
  • We injected the glucose into the patient's vein
Derivationally Related Form:injectantinjectableinjection
Hypernyms:administer dispense
Inherited Hypernyms:injectadministertreat
Direct Hyponyms:immuniseimmunizeinfuseinoculatevaccinate
Full Troponyms:immunizeinfuse
Sentence Frame:Somebody ---s somebody | Somebody ---s somebody with something | Did he --- his foot? (apply to: inject)
adj satadj.allvarying in color when seen in different lights or from different angles
Synset:changeable chatoyant iridescent
Examples:
  • changeable taffeta
  • chatoyant (or shot) silk
  • a dragonfly hovered, vibrating and iridescent
Antonyms:colorless
Derivationally Related Form:changeablenessiridesceiridescence
Inherited Hypernyms:changeable
Similar to:colorful colourful
随便看

 

英语词典包含147479条英英释义在线翻译词条,基本涵盖了全部常用单词的英英翻译及用法,是英语学习的有利工具。

 

Copyright © 2004-2022 Newdu.com All Rights Reserved
更新时间:2025/11/19 6:04:35