英语词汇“shot”的英英意思、用法、释义、翻译、读音、例句、短语、词组-英语词典

Shot

nnoun.actthe act of firing a projectile

Synset:shooting

Examples:

his shooting was slow but accurate

Derivationally Related Form:shoot

Hypernyms:actuation propulsion

Inherited Hypernyms:shootingpropulsionacteventpsychological featureabstractionentity

Direct Hyponyms:countershotdischargefiringfiring offgunfiregunshotheadshotpotshotshellfireshoot

Part Meronyms:fire control

Full Hyponyms:

nnoun.artifacta solid missile discharged from a firearm

Synset:pellet

Examples:

the shot buzzed past his ear

Part Holonyms:canister canister shot case shot

Hypernyms:missile projectile

Inherited Hypernyms:shotprojectileweaponinstrumentdeviceinstrumentalityartifactwholeobjectphysical entityentity

Direct Hyponyms:BBBB shotballbird shotbuckshotduck shotgrapegrapeshotmusket ball

Full Hyponyms:

nnoun.act(sports) the act of swinging or striking at a ball with a club or racket or bat or cue or hand

Topic:athleticssport

Synset:stroke

Examples:

it took two strokes to get out of the bunker
a good shot requires good balance and tempo
he left me an almost impossible shot

Derivationally Related Form:stroke

Hypernyms:maneuver manoeuvre play

Inherited Hypernyms:strokemaneuvermotionchangeactionacteventpsychological featureabstractionentity

Direct Hyponyms:baseball swingbreakcannoncaromcutgolf shotgolf strokemassemasse shotmiscueswingswipetennis shottennis strokeundercut

Part Meronyms:follow-through

Full Hyponyms:

nnoun.statea chance to do something

Domain Usage:colloquialism

Synset:crack

Examples:

he wanted a shot at the champion

Hypernyms:chance opportunity

Inherited Hypernyms:shotopportunitypossibilitybeingstateattributeabstractionentity

nnoun.persona person who shoots (usually with respect to their ability to shoot)

Synset:shooter

Examples:

he is a crack shot
a poor shooter

Derivationally Related Form:shoot

Hypernyms:expert

Inherited Hypernyms:shotexpertpersoncausal agentphysical entityentity

Inherited Hypernyms:shotexpertpersonorganismliving thingwholeobjectphysical entityentity

Direct Hyponyms:crack shotgungunmanmarksmansharpshootertrapshooter

Full Hyponyms:

nnoun.communicationa consecutive series of pictures that constitutes a unit of action in a film

Synset:scene

Part Holonyms:film flick motion-picture show motion picture movie moving-picture show moving picture pic picture picture show

Hypernyms:exposure photo photograph pic picture

Inherited Hypernyms:scenephotographrepresentationcreationartifactwholeobjectphysical entityentity

Direct Hyponyms:outtake

Full Hyponyms:

nnoun.actthe act of putting a liquid into the body by means of a syringe

Synset:injection

Examples:

the nurse gave him a flu shot

Derivationally Related Form:inject

Hypernyms:medical aid medical care

Inherited Hypernyms:injectionmedical caretreatmentcareworkactivityacteventpsychological featureabstractionentity

Direct Hyponyms:intradermal injectionintramuscular injectionintravenous injectionsubcutaneous injection

Full Hyponyms:

nnoun.quantitya small drink of liquor

Synset:nip

Examples:

he poured a shot of whiskey

Hypernyms:small indefinite amount small indefinite quantity

Inherited Hypernyms:nipsmall indefinite quantityindefinite quantitymeasureabstractionentity

nnoun.communicationan aggressive remark directed at a person like a missile and intended to have a telling effect

Synset:barb dig gibe jibe shaft slam

Examples:

his parting shot was 'drop dead'
she threw shafts of sarcasm
she takes a dig at me every chance she gets

Derivationally Related Form:gibe

Hypernyms:comment input remark

Inherited Hypernyms:shotremarkstatementmessagecommunicationabstractionentity

Direct Hyponyms:cheap shot

Full Hyponyms:

nnoun.cognitionan estimate based on little or no information

Synset:dead reckoning guess guessing guesswork

Derivationally Related Form:guess

Hypernyms:approximation estimate estimation idea

Inherited Hypernyms:guessestimatecalculationproblem solvingthinkinghigher cognitive processprocesscognitionpsychological featureabstractionentity

nnoun.artifactan informal photograph; usually made with a small hand-held camera

Synset:snap snapshot

Examples:

my snapshots haven't been developed yet
he tried to get unposed shots of his friends

Derivationally Related Form:snap

Hypernyms:exposure photo photograph pic picture

Inherited Hypernyms:snapshotphotographrepresentationcreationartifactwholeobjectphysical entityentity

nnoun.artifactsports equipment consisting of a heavy metal ball used in the shot put

Examples:

he trained at putting the shot

Hypernyms:sports equipment

Inherited Hypernyms:shotsports equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity

nnoun.artifactan explosive charge used in blasting

Hypernyms:burster bursting charge charge explosive charge

Inherited Hypernyms:shotchargeexplosivechemicalmaterialsubstancematterphysical entityentity

Inherited Hypernyms:shotchargeexplosivechemicalmaterialsubstancepartrelationabstractionentity

nnoun.acta blow hard enough to cause injury

Examples:

he is still recovering from a shot to his leg
I caught him with a solid shot to the chin

Hypernyms:blow

Inherited Hypernyms:shotblowstrokemotionchangeactionacteventpsychological featureabstractionentity

Direct Hyponyms:cheap shot

Full Hyponyms:

nnoun.actan attempt to score in a game

Hypernyms:attempt effort endeavor endeavour try

Inherited Hypernyms:shotattemptactivityacteventpsychological featureabstractionentity

Direct Hyponyms:basketball shotheadshotslapshot

Full Hyponyms:

nnoun.actinformal words for any attempt or effort

Synset:stab

Examples:

he gave it his best shot
he took a stab at forecasting

Hypernyms:attempt effort endeavor endeavour try

Inherited Hypernyms:shotattemptactivityacteventpsychological featureabstractionentity

nnoun.actthe launching of a missile or spacecraft to a specified destination

Synset:blastoff

Derivationally Related Form:blast off

Hypernyms:rocket firing rocket launching

Inherited Hypernyms:blastoffrocket firinglaunchingpropulsionacteventpsychological featureabstractionentity

vverb.competitionhit with a missile from a weapon

Synset:hit pip shoot

Derivationally Related Form:shootershoothitting

Hypernyms:injure wound

Inherited Hypernyms:shootinjurehurtindisposechange

Direct Hyponyms:grassgun downkneecap

Full Troponyms:grassgun downkneecap

Sentence Frame:Somebody ---s something | Somebody ---s somebody

vverb.socialkill by firing a missile

Synset:pip shoot

Derivationally Related Form:shootershooting

Hypernyms:kill

Inherited Hypernyms:shootkill

Direct Hyponyms:flightpick off

Full Troponyms:flightpick off

Sentence Frame:Somebody ---s somebody | They want to --- the prisoners (apply to: shoot)

vverb.competitionfire a shot

Synset:blast shoot

Examples:

the gunman blasted away

Derivationally Related Form:shootershootshooting

Hypernyms:discharge fire

Inherited Hypernyms:blastfire

Direct Hyponyms:blazeblaze awayfiregunopen fireovershootpumpsharpshootsnipe

Full Troponyms:blaze awaygunmachine gunopen fireovershootpumpsharpshoot

Sentence Frame:Somebody ---s something | Somebody ---s | Somebody ---s PP

vverb.communicationmake a film or photograph of something

Topic:filmflickmotion-picture showmotion picturemoviemoving-picture showmoving picturepicpicturepicture show

Synset:film shoot take

Examples:

take a scene
shoot a movie

Derivationally Related Form:takefilmfilming

Hypernyms:enter put down record

Inherited Hypernyms:filmrecordsavekeephave

Direct Hyponyms:reshoot

Full Troponyms:reshoot

Sentence Frame:Somebody ---s something | Somebody ---s somebody | Somebody ---s (apply to: film) | Sam cannot --- Sue (apply to: take) | Sam and Sue --- the movie (apply to: shoot, film)

vverb.motionsend forth suddenly, intensely, swiftly

Examples:

shoot a glance

Hypernyms:cast contrive project throw

Inherited Hypernyms:shootprojectsendmove

Sentence Frame:Somebody ---s something

vverb.motionrun or move very quickly or hastily

Synset:dart dash flash scoot scud shoot

Examples:

She dashed into the yard

Derivationally Related Form:dashdartscooter

Hypernyms:belt along bucket along cannonball along hasten hie hotfoot pelt along race rush rush along speed step on it

Inherited Hypernyms:dartrushtravel

Direct Hyponyms:plunge

Full Troponyms:plunge

Sentence Frame:Something is ---ing PP | Somebody ---s PP

vverb.motionmove quickly and violently

Synset:buck charge shoot shoot down tear

Examples:

The car tore down the street
He came charging into my office

Hypernyms:belt along bucket along cannonball along hasten hie hotfoot pelt along race rush rush along speed step on it

Inherited Hypernyms:tearrushtravel

Direct Hyponyms:rip

Full Troponyms:rip

Sentence Frame:Something is ---ing PP | Somebody ---s PP

vverb.contactthrow or propel in a specific direction or towards a specific objective

Examples:

shoot craps
shoot a golf ball

Derivationally Related Form:shooter

Hypernyms:hit

Inherited Hypernyms:shoothitpropelmove

Direct Hyponyms:birdiebogeybreakcaromchipdouble birdiedouble bogeydunkeagleknuckle

Full Troponyms:birdiebogeybreakcaromchipdouble bogeydunkeagleknuckleslam-dunk

Sentence Frame:Somebody ---s something | Somebody ---s

vverb.communicationrecord on photographic film

Topic:photographypicture taking

Synset:photograph shoot snap

Examples:

I photographed the scene of the accident
She snapped a picture of the President

Derivationally Related Form:photographsnapphotographer

Hypernyms:enter put down record

Inherited Hypernyms:photographrecordsavekeephave

Direct Hyponyms:retakex-ray

Full Troponyms:retakex-ray

Sentence Frame:Somebody ---s something | Somebody ---s somebody | Somebody ---s

vverb.weatheremit (as light, flame, or fumes) suddenly and forcefully

Examples:

The dragon shot fumes and flames out of its mouth

Hypernyms:emit give off give out

Inherited Hypernyms:shootemit

Sentence Frame:Something ---s something

vverb.perceptioncause a sharp and sudden pain in

Examples:

The pain shot up her leg

Hypernyms:ache hurt smart

Inherited Hypernyms:shootachecause to be perceived

Sentence Frame:Something is ---ing PP

vverb.contactforce or drive (a fluid or gas) into by piercing

Synset:inject shoot

Examples:

inject hydrogen into the balloon

Derivationally Related Form:injectableinjectorinjection

Hypernyms:enclose inclose insert introduce put in stick in

Inherited Hypernyms:injectinsertputmove

Sentence Frame:Somebody ---s somebody | Somebody ---s somebody with something | They --- a chemical into the fruit (apply to: inject, shoot) | They --- the fruit with a chemical (apply to: inject, shoot)

vverb.contactvariegate by interweaving weft threads of different colors

Examples:

shoot cloth

Hypernyms:interweave weave

Inherited Hypernyms:shootweavetwistchange shapechange

Sentence Frame:Somebody ---s something

vverb.contactthrow dice, as in a crap game

Derivationally Related Form:shooter

Hypernyms:throw

Inherited Hypernyms:shootthrowturntransmitmove

Sentence Frame:Somebody ---s

vverb.consumptionspend frivolously and unwisely

Synset:dissipate fool fool away fritter fritter away frivol away shoot

Examples:

Fritter away one's inheritance

Derivationally Related Form:dissipation

Hypernyms:consume squander ware waste

Inherited Hypernyms:fritterconsumespendpaygivetransfer

Entailment:consume deplete eat up eat exhaust run through use up wipe out

Sentence Frame:Somebody ---s something

vverb.competitionscore

Topic:athleticssport

Examples:

shoot a basket
shoot a goal

Hypernyms:hit rack up score tally

Inherited Hypernyms:shootscoregain

Sentence Frame:Somebody ---s something

vverb.communicationutter fast and forcefully

Examples:

She shot back an answer

Hypernyms:emit let loose let out utter

Inherited Hypernyms:shootutter

Sentence Frame:Somebody ---s something

vverb.cognitionmeasure the altitude of by using a sextant

Examples:

shoot a star

Hypernyms:measure measure out mensurate

Inherited Hypernyms:shootmeasuredecide

Sentence Frame:Somebody ---s something

vverb.changeproduce buds, branches, or germinate

Synset:bourgeon burgeon forth germinate pullulate shoot sprout spud

Examples:

the potatoes sprouted

Derivationally Related Form:shootsproutgerminationpullulationgermsprouting

Hypernyms:grow

Inherited Hypernyms:shootgrowdevelopgrowincreasechange magnitudechange

Sentence Frame:Something ---s

vverb.bodygive an injection to

Topic:medicinepractice of medicine

Synset:inject shoot

Examples:

We injected the glucose into the patient's vein

Derivationally Related Form:injectantinjectableinjection

Hypernyms:administer dispense

Inherited Hypernyms:injectadministertreat

Direct Hyponyms:immuniseimmunizeinfuseinoculatevaccinate

Full Troponyms:immunizeinfuse

Sentence Frame:Somebody ---s somebody | Somebody ---s somebody with something | Did he --- his foot? (apply to: inject)

adj satadj.allvarying in color when seen in different lights or from different angles

Synset:changeable chatoyant iridescent

Examples:

changeable taffeta
chatoyant (or shot) silk
a dragonfly hovered, vibrating and iridescent

Antonyms:colorless

Derivationally Related Form:changeablenessiridesceiridescence

Inherited Hypernyms:changeable

Similar to:colorful colourful

单词	shot
释义	Shot nnoun.actthe act of firing a projectile Synset:shooting Examples: his shooting was slow but accurate Derivationally Related Form:shoot Hypernyms:actuation propulsion Inherited Hypernyms:shootingpropulsionacteventpsychological featureabstractionentity Direct Hyponyms:countershotdischargefiringfiring offgunfiregunshotheadshotpotshotshellfireshoot Part Meronyms:fire control Full Hyponyms: countershotdischargeenfiladegungunfireheadshotpotshotshellfireshootskeetsnipe nnoun.artifacta solid missile discharged from a firearm Synset:pellet Examples: the shot buzzed past his ear Part Holonyms:canister canister shot case shot Hypernyms:missile projectile Inherited Hypernyms:shotprojectileweaponinstrumentdeviceinstrumentalityartifactwholeobjectphysical entityentity Direct Hyponyms:BBBB shotballbird shotbuckshotduck shotgrapegrapeshotmusket ball Full Hyponyms: bbbird shotgrapeshotmusket ball nnoun.act(sports) the act of swinging or striking at a ball with a club or racket or bat or cue or hand Topic:athleticssport Synset:stroke Examples: it took two strokes to get out of the bunker a good shot requires good balance and tempo he left me an almost impossible shot Derivationally Related Form:stroke Hypernyms:maneuver manoeuvre play Inherited Hypernyms:strokemaneuvermotionchangeactionacteventpsychological featureabstractionentity Direct Hyponyms:baseball swingbreakcannoncaromcutgolf shotgolf strokemassemasse shotmiscueswingswipetennis shottennis strokeundercut Part Meronyms:follow-through Full Hyponyms: aceapproachbackhandbackhand drivebaseball swingbreakcaromchipchopcutdouble faultdownswingdrivedrop shotexplosionfaultfootfaultforehandforehand drivegetgolf strokeground strokehalf volleyhookletlobmassemiscueoverheadpassing shotpitchputtreturnsclaffserveshanksliceswipeteeofftennis stroketwo-handed backhandvolley nnoun.statea chance to do something Domain Usage:colloquialism Synset:crack Examples: he wanted a shot at the champion Hypernyms:chance opportunity Inherited Hypernyms:shotopportunitypossibilitybeingstateattributeabstractionentity nnoun.persona person who shoots (usually with respect to their ability to shoot) Synset:shooter Examples: he is a crack shot a poor shooter Derivationally Related Form:shoot Hypernyms:expert Inherited Hypernyms:shotexpertpersoncausal agentphysical entityentity Inherited Hypernyms:shotexpertpersonorganismliving thingwholeobjectphysical entityentity Direct Hyponyms:crack shotgungunmanmarksmansharpshootertrapshooter Full Hyponyms: deadeyefranc-tireurgunmanmarksmanriflemansnipertrapshooter nnoun.communicationa consecutive series of pictures that constitutes a unit of action in a film Synset:scene Part Holonyms:film flick motion-picture show motion picture movie moving-picture show moving picture pic picture picture show Hypernyms:exposure photo photograph pic picture Inherited Hypernyms:scenephotographrepresentationcreationartifactwholeobjectphysical entityentity Direct Hyponyms:outtake Full Hyponyms: outtake nnoun.actthe act of putting a liquid into the body by means of a syringe Synset:injection Examples: the nurse gave him a flu shot Derivationally Related Form:inject Hypernyms:medical aid medical care Inherited Hypernyms:injectionmedical caretreatmentcareworkactivityacteventpsychological featureabstractionentity Direct Hyponyms:intradermal injectionintramuscular injectionintravenous injectionsubcutaneous injection Full Hyponyms: fixintradermal injectionintramuscular injectionintravenous injectionsubcutaneous injection nnoun.quantitya small drink of liquor Synset:nip Examples: he poured a shot of whiskey Hypernyms:small indefinite amount small indefinite quantity Inherited Hypernyms:nipsmall indefinite quantityindefinite quantitymeasureabstractionentity nnoun.communicationan aggressive remark directed at a person like a missile and intended to have a telling effect Synset:barb dig gibe jibe shaft slam Examples: his parting shot was 'drop dead' she threw shafts of sarcasm she takes a dig at me every chance she gets Derivationally Related Form:gibe Hypernyms:comment input remark Inherited Hypernyms:shotremarkstatementmessagecommunicationabstractionentity Direct Hyponyms:cheap shot Full Hyponyms: cheap shot nnoun.cognitionan estimate based on little or no information Synset:dead reckoning guess guessing guesswork Derivationally Related Form:guess Hypernyms:approximation estimate estimation idea Inherited Hypernyms:guessestimatecalculationproblem solvingthinkinghigher cognitive processprocesscognitionpsychological featureabstractionentity nnoun.artifactan informal photograph; usually made with a small hand-held camera Synset:snap snapshot Examples: my snapshots haven't been developed yet he tried to get unposed shots of his friends Derivationally Related Form:snap Hypernyms:exposure photo photograph pic picture Inherited Hypernyms:snapshotphotographrepresentationcreationartifactwholeobjectphysical entityentity nnoun.artifactsports equipment consisting of a heavy metal ball used in the shot put Examples: he trained at putting the shot Hypernyms:sports equipment Inherited Hypernyms:shotsports equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity nnoun.artifactan explosive charge used in blasting Hypernyms:burster bursting charge charge explosive charge Inherited Hypernyms:shotchargeexplosivechemicalmaterialsubstancematterphysical entityentity Inherited Hypernyms:shotchargeexplosivechemicalmaterialsubstancepartrelationabstractionentity nnoun.acta blow hard enough to cause injury Examples: he is still recovering from a shot to his leg I caught him with a solid shot to the chin Hypernyms:blow Inherited Hypernyms:shotblowstrokemotionchangeactionacteventpsychological featureabstractionentity Direct Hyponyms:cheap shot Full Hyponyms: cheap shot nnoun.actan attempt to score in a game Hypernyms:attempt effort endeavor endeavour try Inherited Hypernyms:shotattemptactivityacteventpsychological featureabstractionentity Direct Hyponyms:basketball shotheadshotslapshot Full Hyponyms: bank shotbasketball shotdunkfinger-rollfoul shotheadshothook shotjumperlay-upone-and-onepivot shotscoop shotset shotslam dunkslapshottip in nnoun.actinformal words for any attempt or effort Synset:stab Examples: he gave it his best shot he took a stab at forecasting Hypernyms:attempt effort endeavor endeavour try Inherited Hypernyms:shotattemptactivityacteventpsychological featureabstractionentity nnoun.actthe launching of a missile or spacecraft to a specified destination Synset:blastoff Derivationally Related Form:blast off Hypernyms:rocket firing rocket launching Inherited Hypernyms:blastoffrocket firinglaunchingpropulsionacteventpsychological featureabstractionentity vverb.competitionhit with a missile from a weapon Synset:hit pip shoot Derivationally Related Form:shootershoothitting Hypernyms:injure wound Inherited Hypernyms:shootinjurehurtindisposechange Direct Hyponyms:grassgun downkneecap Full Troponyms:grassgun downkneecap Sentence Frame:Somebody ---s something \| Somebody ---s somebody vverb.socialkill by firing a missile Synset:pip shoot Derivationally Related Form:shootershooting Hypernyms:kill Inherited Hypernyms:shootkill Direct Hyponyms:flightpick off Full Troponyms:flightpick off Sentence Frame:Somebody ---s somebody \| They want to --- the prisoners (apply to: shoot) vverb.competitionfire a shot Synset:blast shoot Examples: the gunman blasted away Derivationally Related Form:shootershootshooting Hypernyms:discharge fire Inherited Hypernyms:blastfire Direct Hyponyms:blazeblaze awayfiregunopen fireovershootpumpsharpshootsnipe Full Troponyms:blaze awaygunmachine gunopen fireovershootpumpsharpshoot Sentence Frame:Somebody ---s something \| Somebody ---s \| Somebody ---s PP vverb.communicationmake a film or photograph of something Topic:filmflickmotion-picture showmotion picturemoviemoving-picture showmoving picturepicpicturepicture show Synset:film shoot take Examples: take a scene shoot a movie Derivationally Related Form:takefilmfilming Hypernyms:enter put down record Inherited Hypernyms:filmrecordsavekeephave Direct Hyponyms:reshoot Full Troponyms:reshoot Sentence Frame:Somebody ---s something \| Somebody ---s somebody \| Somebody ---s (apply to: film) \| Sam cannot --- Sue (apply to: take) \| Sam and Sue --- the movie (apply to: shoot, film) vverb.motionsend forth suddenly, intensely, swiftly Examples: shoot a glance Hypernyms:cast contrive project throw Inherited Hypernyms:shootprojectsendmove Sentence Frame:Somebody ---s something vverb.motionrun or move very quickly or hastily Synset:dart dash flash scoot scud shoot Examples: She dashed into the yard Derivationally Related Form:dashdartscooter Hypernyms:belt along bucket along cannonball along hasten hie hotfoot pelt along race rush rush along speed step on it Inherited Hypernyms:dartrushtravel Direct Hyponyms:plunge Full Troponyms:plunge Sentence Frame:Something is ---ing PP \| Somebody ---s PP vverb.motionmove quickly and violently Synset:buck charge shoot shoot down tear Examples: The car tore down the street He came charging into my office Hypernyms:belt along bucket along cannonball along hasten hie hotfoot pelt along race rush rush along speed step on it Inherited Hypernyms:tearrushtravel Direct Hyponyms:rip Full Troponyms:rip Sentence Frame:Something is ---ing PP \| Somebody ---s PP vverb.contactthrow or propel in a specific direction or towards a specific objective Examples: shoot craps shoot a golf ball Derivationally Related Form:shooter Hypernyms:hit Inherited Hypernyms:shoothitpropelmove Direct Hyponyms:birdiebogeybreakcaromchipdouble birdiedouble bogeydunkeagleknuckle Full Troponyms:birdiebogeybreakcaromchipdouble bogeydunkeagleknuckleslam-dunk Sentence Frame:Somebody ---s something \| Somebody ---s vverb.communicationrecord on photographic film Topic:photographypicture taking Synset:photograph shoot snap Examples: I photographed the scene of the accident She snapped a picture of the President Derivationally Related Form:photographsnapphotographer Hypernyms:enter put down record Inherited Hypernyms:photographrecordsavekeephave Direct Hyponyms:retakex-ray Full Troponyms:retakex-ray Sentence Frame:Somebody ---s something \| Somebody ---s somebody \| Somebody ---s vverb.weatheremit (as light, flame, or fumes) suddenly and forcefully Examples: The dragon shot fumes and flames out of its mouth Hypernyms:emit give off give out Inherited Hypernyms:shootemit Sentence Frame:Something ---s something vverb.perceptioncause a sharp and sudden pain in Examples: The pain shot up her leg Hypernyms:ache hurt smart Inherited Hypernyms:shootachecause to be perceived Sentence Frame:Something is ---ing PP vverb.contactforce or drive (a fluid or gas) into by piercing Synset:inject shoot Examples: inject hydrogen into the balloon Derivationally Related Form:injectableinjectorinjection Hypernyms:enclose inclose insert introduce put in stick in Inherited Hypernyms:injectinsertputmove Sentence Frame:Somebody ---s somebody \| Somebody ---s somebody with something \| They --- a chemical into the fruit (apply to: inject, shoot) \| They --- the fruit with a chemical (apply to: inject, shoot) vverb.contactvariegate by interweaving weft threads of different colors Examples: shoot cloth Hypernyms:interweave weave Inherited Hypernyms:shootweavetwistchange shapechange Sentence Frame:Somebody ---s something vverb.contactthrow dice, as in a crap game Derivationally Related Form:shooter Hypernyms:throw Inherited Hypernyms:shootthrowturntransmitmove Sentence Frame:Somebody ---s vverb.consumptionspend frivolously and unwisely Synset:dissipate fool fool away fritter fritter away frivol away shoot Examples: Fritter away one's inheritance Derivationally Related Form:dissipation Hypernyms:consume squander ware waste Inherited Hypernyms:fritterconsumespendpaygivetransfer Entailment:consume deplete eat up eat exhaust run through use up wipe out Sentence Frame:Somebody ---s something vverb.competitionscore Topic:athleticssport Examples: shoot a basket shoot a goal Hypernyms:hit rack up score tally Inherited Hypernyms:shootscoregain Sentence Frame:Somebody ---s something vverb.communicationutter fast and forcefully Examples: She shot back an answer Hypernyms:emit let loose let out utter Inherited Hypernyms:shootutter Sentence Frame:Somebody ---s something vverb.cognitionmeasure the altitude of by using a sextant Examples: shoot a star Hypernyms:measure measure out mensurate Inherited Hypernyms:shootmeasuredecide Sentence Frame:Somebody ---s something vverb.changeproduce buds, branches, or germinate Synset:bourgeon burgeon forth germinate pullulate shoot sprout spud Examples: the potatoes sprouted Derivationally Related Form:shootsproutgerminationpullulationgermsprouting Hypernyms:grow Inherited Hypernyms:shootgrowdevelopgrowincreasechange magnitudechange Sentence Frame:Something ---s vverb.bodygive an injection to Topic:medicinepractice of medicine Synset:inject shoot Examples: We injected the glucose into the patient's vein Derivationally Related Form:injectantinjectableinjection Hypernyms:administer dispense Inherited Hypernyms:injectadministertreat Direct Hyponyms:immuniseimmunizeinfuseinoculatevaccinate Full Troponyms:immunizeinfuse Sentence Frame:Somebody ---s somebody \| Somebody ---s somebody with something \| Did he --- his foot? (apply to: inject) adj satadj.allvarying in color when seen in different lights or from different angles Synset:changeable chatoyant iridescent Examples: changeable taffeta chatoyant (or shot) silk a dragonfly hovered, vibrating and iridescent Antonyms:colorless Derivationally Related Form:changeablenessiridesceiridescence Inherited Hypernyms:changeable Similar to:colorful colourful
随便看	double-spaced double-spacing doublespeak double standard double standard of sexual behavior double star double stitch double stopping doublet double take double talk double-team doublethink double time doubleton double tongue double-tongued doubletree double-u double up double vision doubling doubloon doubly doubly transitive verb