英语词汇“ordered”的英英意思、用法、释义、翻译、读音、例句、短语、词组-英语词典

Ordered

vverb.communicationgive instructions to or direct somebody to do something with authority

Synset:enjoin order say tell

Examples:

I said to him to go home
She ordered him to do the shopping
The mother told the child to get dressed

Derivationally Related Form:injunctionorder

Hypernyms:request

Inherited Hypernyms:orderrequestaskrequestcommunicateconveytransfermove

Direct Hyponyms:callcommanddirectinstructprescriberequiresend forwarn

Full Troponyms:adjurebanbarbear downbeckonbeepbuzzcallcall incall upchargecommandconvokedemanddirectembargoenjoinforbidhailinstructliftmusteroutlawoverburdenoverwhelmpageprescriberecallrequisitionstetsummonvouchwarn

Sentence Frame:Somebody ---s somebody to INFINITIVE | Somebody ---s that CLAUSE | They --- him to write the letter (apply to: order, enjoin, tell)

vverb.communicationmake a request for something

Examples:

Order me some flowers
order a work stoppage

Derivationally Related Form:orderorderer

Hypernyms:ask for bespeak call for quest request

Inherited Hypernyms:orderrequestcommunicateconveytransfermove

Direct Hyponyms:callcommissionplacereorderwish

Full Troponyms:callcommissionplacereorderwish

Sentence Frame:Somebody ---s something | Somebody ---s something from somebody

vverb.communicationissue commands or orders for

Synset:dictate order prescribe

Derivationally Related Form:dictateprescriptionorderdictatorprescriptivedictation

Hypernyms:bring down impose inflict visit

Inherited Hypernyms:orderinflictcommunicateinteractact

Direct Hyponyms:mandate

Full Troponyms:mandate

Sentence Frame:Somebody ---s something | Somebody ---s to somebody (apply to: dictate)

vverb.socialbring into conformity with rules or principles or usage; impose regulations

Synset:govern order regularise regularize regulate

Examples:

We cannot regulate the way people dress
This town likes to regulate

Antonyms:deregulate

Derivationally Related Form:orderregulatorgovernorregulationregulatinggovernment

Hypernyms:decide determine make up one's mind

Inherited Hypernyms:regulatedecide

Direct Hyponyms:districtstandardisestandardizezone

Full Troponyms:gaugestandardizezone

Sentence Frame:Somebody ---s something | Somebody ---s | Something ---s something

vverb.changebring order to or into

Examples:

Order these files

Antonyms:disorder

Derivationally Related Form:orderordererordering

Hypernyms:arrange set up

Inherited Hypernyms:orderarrangeputmove

Direct Hyponyms:clean upcollatedisentangleneatensquare awaystraightenstraighten outsystematisesystematizesystemisesystemizetidytidy upunsnarl

Full Troponyms:codifycollatedigestdisentangleghousecleanmakeravelspring-cleansystematizeteasetidy

Sentence Frame:Somebody ---s something | Something ---s something

vverb.changeplace in a certain order

Examples:

order the photos chronologically

Derivationally Related Form:orderordererordering

Hypernyms:arrange set up

Inherited Hypernyms:orderarrangeputmove

Sentence Frame:Somebody ---s something | Somebody ---s somebody

vverb.socialappoint to a clerical posts

Synset:consecrate ordain order ordinate

Examples:

he was ordained in the Church

Derivationally Related Form:ordainerordinanceconsecrationorder

Hypernyms:enthrone invest vest

Inherited Hypernyms:ordaininvestinstall

Sentence Frame:Somebody ---s somebody | Somebody ---s somebody PP

vverb.cognitionarrange thoughts, ideas, temporal events

Synset:arrange order put set up

Examples:

arrange my schedule
set up one's life
I put these memories with those of bygone times

Derivationally Related Form:orderordering

Hypernyms:organise organize

Inherited Hypernyms:arrangeorganizemanagecontrol

Direct Hyponyms:contemporisecontemporizephrasesynchronisesynchronize

Full Troponyms:phrasesynchronize

Sentence Frame:Somebody ---s something

vverb.cognitionassign a rank or rating to

Synset:grade order place range rank rate

Examples:

how would you rank these students?
The restaurant is rated highly in the food guide

Derivationally Related Form:orderingorderrankplacegradergradationgradegrading

Hypernyms:evaluate judge pass judgment

Inherited Hypernyms:rateevaluatethink

Direct Hyponyms:downgradeprioritiseprioritizereorderseedsequenceshortlistsubordinatesuperordinateupgrade

Full Troponyms:countermarchdowngradeinvertoutclassprioritizereorderseedsequenceshortlistsubordinatesuperordinateupgrade

Sentence Frame:Somebody ---s something | Somebody ---s somebody | Sam and Sue --- the movie (apply to: rate)

adjadj.allhaving a systematic arrangement; especially having elements succeeding in order according to rule

Examples:

an ordered sequence

Antonyms:disordered

Inherited Hypernyms:ordered

Similar to:consecutive sequent sequential serial successive progressive

adjadj.alldisposed or placed in a particular kind of order

Synset:arranged

Examples:

the carefully arranged chessmen
haphazardly arranged interlobular septa
comfortable chairs arranged around the fireplace

Antonyms:disarranged

Inherited Hypernyms:arranged

Similar to:laid set placed

adjadj.allmarked by an orderly, logical, and aesthetically consistent relation of parts

Synset:coherent consistent logical

Examples:

a coherent argument

Antonyms:incoherent

Derivationally Related Form:cohereconsistencecoherencecoherency

Inherited Hypernyms:coherent

Similar to:seamless

单词	ordered
释义	Ordered vverb.communicationgive instructions to or direct somebody to do something with authority Synset:enjoin order say tell Examples: I said to him to go home She ordered him to do the shopping The mother told the child to get dressed Derivationally Related Form:injunctionorder Hypernyms:request Inherited Hypernyms:orderrequestaskrequestcommunicateconveytransfermove Direct Hyponyms:callcommanddirectinstructprescriberequiresend forwarn Full Troponyms:adjurebanbarbear downbeckonbeepbuzzcallcall incall upchargecommandconvokedemanddirectembargoenjoinforbidhailinstructliftmusteroutlawoverburdenoverwhelmpageprescriberecallrequisitionstetsummonvouchwarn Sentence Frame:Somebody ---s somebody to INFINITIVE \| Somebody ---s that CLAUSE \| They --- him to write the letter (apply to: order, enjoin, tell) vverb.communicationmake a request for something Examples: Order me some flowers order a work stoppage Derivationally Related Form:orderorderer Hypernyms:ask for bespeak call for quest request Inherited Hypernyms:orderrequestcommunicateconveytransfermove Direct Hyponyms:callcommissionplacereorderwish Full Troponyms:callcommissionplacereorderwish Sentence Frame:Somebody ---s something \| Somebody ---s something from somebody vverb.communicationissue commands or orders for Synset:dictate order prescribe Derivationally Related Form:dictateprescriptionorderdictatorprescriptivedictation Hypernyms:bring down impose inflict visit Inherited Hypernyms:orderinflictcommunicateinteractact Direct Hyponyms:mandate Full Troponyms:mandate Sentence Frame:Somebody ---s something \| Somebody ---s to somebody (apply to: dictate) vverb.socialbring into conformity with rules or principles or usage; impose regulations Synset:govern order regularise regularize regulate Examples: We cannot regulate the way people dress This town likes to regulate Antonyms:deregulate Derivationally Related Form:orderregulatorgovernorregulationregulatinggovernment Hypernyms:decide determine make up one's mind Inherited Hypernyms:regulatedecide Direct Hyponyms:districtstandardisestandardizezone Full Troponyms:gaugestandardizezone Sentence Frame:Somebody ---s something \| Somebody ---s \| Something ---s something vverb.changebring order to or into Examples: Order these files Antonyms:disorder Derivationally Related Form:orderordererordering Hypernyms:arrange set up Inherited Hypernyms:orderarrangeputmove Direct Hyponyms:clean upcollatedisentangleneatensquare awaystraightenstraighten outsystematisesystematizesystemisesystemizetidytidy upunsnarl Full Troponyms:codifycollatedigestdisentangleghousecleanmakeravelspring-cleansystematizeteasetidy Sentence Frame:Somebody ---s something \| Something ---s something vverb.changeplace in a certain order Examples: order the photos chronologically Derivationally Related Form:orderordererordering Hypernyms:arrange set up Inherited Hypernyms:orderarrangeputmove Sentence Frame:Somebody ---s something \| Somebody ---s somebody vverb.socialappoint to a clerical posts Synset:consecrate ordain order ordinate Examples: he was ordained in the Church Derivationally Related Form:ordainerordinanceconsecrationorder Hypernyms:enthrone invest vest Inherited Hypernyms:ordaininvestinstall Sentence Frame:Somebody ---s somebody \| Somebody ---s somebody PP vverb.cognitionarrange thoughts, ideas, temporal events Synset:arrange order put set up Examples: arrange my schedule set up one's life I put these memories with those of bygone times Derivationally Related Form:orderordering Hypernyms:organise organize Inherited Hypernyms:arrangeorganizemanagecontrol Direct Hyponyms:contemporisecontemporizephrasesynchronisesynchronize Full Troponyms:phrasesynchronize Sentence Frame:Somebody ---s something vverb.cognitionassign a rank or rating to Synset:grade order place range rank rate Examples: how would you rank these students? The restaurant is rated highly in the food guide Derivationally Related Form:orderingorderrankplacegradergradationgradegrading Hypernyms:evaluate judge pass judgment Inherited Hypernyms:rateevaluatethink Direct Hyponyms:downgradeprioritiseprioritizereorderseedsequenceshortlistsubordinatesuperordinateupgrade Full Troponyms:countermarchdowngradeinvertoutclassprioritizereorderseedsequenceshortlistsubordinatesuperordinateupgrade Sentence Frame:Somebody ---s something \| Somebody ---s somebody \| Sam and Sue --- the movie (apply to: rate) adjadj.allhaving a systematic arrangement; especially having elements succeeding in order according to rule Examples: an ordered sequence Antonyms:disordered Inherited Hypernyms:ordered Similar to:consecutive sequent sequential serial successive progressive adjadj.alldisposed or placed in a particular kind of order Synset:arranged Examples: the carefully arranged chessmen haphazardly arranged interlobular septa comfortable chairs arranged around the fireplace Antonyms:disarranged Inherited Hypernyms:arranged Similar to:laid set placed adjadj.allmarked by an orderly, logical, and aesthetically consistent relation of parts Synset:coherent consistent logical Examples: a coherent argument Antonyms:incoherent Derivationally Related Form:cohereconsistencecoherencecoherency Inherited Hypernyms:coherent Similar to:seamless See also:logical rational
随便看	sodium sulfate sodium sulphate sodium thiopental sodium thiosulfate sodium thiosulphate sodium tripolyphosphate sodium-vapor lamp sodium-vapour lamp sodoku sodom sodomise sodomist sodomite sodomize sodomy sod's law sofa sofa bed so far soffit sofia sofia scicolone soft softback softback book