英语词汇“opening”的英英意思、用法、释义、翻译、读音、例句、短语、词组-英语词典

nnoun.objectan open or empty space in or between things

Synset:gap

Examples:

there was a small opening between the trees
the explosion made a gap in the wall

Derivationally Related Form:gapopen

Part Holonyms:Earth's surface surface

Hypernyms:space

Inherited Hypernyms:openingspaceamorphous shapeshapeattributeabstractionentity

Inherited Hypernyms:openingspacelocationobjectphysical entityentity

Direct Hyponyms:Ranvier's nodesbreachchasmcleftcrackcrevicediastemafissureforamenhiatusholemouthnodes of Ranvierpocketrentriftripscissuresnagsplittearwindow

Full Hyponyms:

nnoun.eventa ceremony accompanying the start of some enterprise

Derivationally Related Form:open

Hypernyms:ceremonial ceremonial occasion ceremony observance

Inherited Hypernyms:openingceremonyaffairsocial eventeventpsychological featureabstractionentity

nnoun.actbecoming open or being made open

Examples:

the opening of his arms was the sign I was waiting for

Derivationally Related Form:open

Hypernyms:change of integrity

Inherited Hypernyms:openingchange of integritychangeactionacteventpsychological featureabstractionentity

Direct Hyponyms:cutcutting

Full Hyponyms:

nnoun.eventthe first performance (as of a theatrical production)

Synset:curtain raising opening night

Examples:

the opening received good critical reviews

Derivationally Related Form:opening

Hypernyms:start

Inherited Hypernyms:openingstartbeginninghappeningeventpsychological featureabstractionentity

nnoun.actthe act of opening something

Examples:

the ray of light revealed his cautious opening of the door

Antonyms:closing

Derivationally Related Form:open

Hypernyms:motility motion move movement

Inherited Hypernyms:openingmotionchangeactionacteventpsychological featureabstractionentity

nnoun.stateopportunity especially for employment or promotion

Examples:

there is an opening in the sales department

Derivationally Related Form:open

Hypernyms:chance opportunity

Inherited Hypernyms:openingopportunitypossibilitybeingstateattributeabstractionentity

nnoun.communicationthe initial part of the introduction

Examples:

the opening established the basic theme

Hypernyms:introduction

Inherited Hypernyms:openingintroductionsectionmusicauditory communicationcommunicationabstractionentity

Inherited Hypernyms:openingintroductionsectionwritingwritten communicationcommunicationabstractionentity

Direct Hyponyms:salutationteaser

Full Hyponyms:

nnoun.cognitiona possible alternative

Synset:possibility possible action

Examples:

bankruptcy is always a possibility

Derivationally Related Form:possible

Hypernyms:alternative choice option

Inherited Hypernyms:possibilityoptiondecision makinghigher cognitive processprocesscognitionpsychological featureabstractionentity

Direct Hyponyms:possible

Full Hyponyms:

nnoun.bodyan aperture or hole that opens into a bodily cavity

Synset:orifice porta

Examples:

the orifice into the aorta from the lower left chamber of the heart

Derivationally Related Form:open

Hypernyms:passage passageway

Inherited Hypernyms:orificepassagestructurebody partpartthingphysical entityentity

Direct Hyponyms:anusaortic orificeblastoporecardiacervixcervix uteriexternal orificefenestrafontanelfontanelleintroitusmouthnarisosporta hepatispylorusrimasoft spotspiraclestomaurethral orificeuterine cervixvent

Full Hyponyms:

nnoun.artifacta vacant or unobstructed space that is man-made

Examples:

they left a small opening for the cat at the bottom of the door

Hypernyms:artefact artifact

Inherited Hypernyms:openingartifactwholeobjectphysical entityentity

Direct Hyponyms:aperturebellbreechcrackembrasureexitfenestellaflyfly frontgapgrillegun muzzleholeinletintakeintersticeissuelatticelunettemouthmuzzleneckneck openingoutletpass-throughportportholerear of barrelrear of tubeslitspoutthroatway outwicketwindow

Full Hyponyms:

nnoun.artifactan entrance equipped with a hatch; especially a passageway between decks of a ship

Synset:hatchway scuttle

Derivationally Related Form:open

Hypernyms:entrance entranceway entree entry entryway

Inherited Hypernyms:hatchwayentranceaccesswayartifactwholeobjectphysical entityentity

Direct Hyponyms:escape hatch

Part Meronyms:hatch

Full Hyponyms:

nnoun.acta recognized sequence of moves at the beginning of a game of chess

Topic:chesschess game

Synset:chess opening

Examples:

he memorized all the important chess openings

Hypernyms:sequence succession

Inherited Hypernyms:openingsuccessionorderorganizationactivityacteventpsychological featureabstractionentity

nnoun.actthe first of a series of actions

Synset:first step initiative opening move

Derivationally Related Form:openopening

Hypernyms:beginning commencement start

Inherited Hypernyms:first stepbeginningchange of statechangeactionacteventpsychological featureabstractionentity

Direct Hyponyms:curtain raiserfirst basepeace initiative

Full Hyponyms:

vverb.contactcause to open or to become open

Synset:open open up

Examples:

Mary opened the car door

Antonyms:close

Derivationally Related Form:openingopener

Inherited Hypernyms:open

Direct Hyponyms:breachbreak openclick opengapjimmylanceleverpriseprizepryreopenunbarunboltuncorkunlockunseal

Causes:open up open

Full Troponyms:break openclick opengaplancepryreopenunbarunboltuncorkunlockunseal

Sentence Frame:Somebody ---s something | Something ---s something | They want to --- the doors (apply to: open, open up)

vverb.socialstart to operate or function or cause to start operating or functioning

Synset:open open up

Examples:

open a business

Antonyms:close

Derivationally Related Form:opening

Inherited Hypernyms:open

Direct Hyponyms:establishfoundlaunchset up

Full Troponyms:establish

Sentence Frame:Somebody ---s something | Something ---s | The business is going to --- (apply to: open, open up)

vverb.contactbecome open

Synset:open open up

Examples:

The door opened

Antonyms:close

Derivationally Related Form:opening

Hypernyms:change state turn

Inherited Hypernyms:openchange statechange

Direct Hyponyms:fly openunfasten

Full Troponyms:fly openunfasten

Sentence Frame:Something ---s | The doors --- (apply to: open, open up)

vverb.socialbegin or set in action, of meetings, speeches, recitals, etc.

Examples:

He opened the meeting with a long speech

Antonyms:close

Derivationally Related Form:openingopener

Hypernyms:commence embark on start start up

Inherited Hypernyms:openstartbegin

Direct Hyponyms:call to orderinaugurate

Full Troponyms:call to orderinaugurate

Sentence Frame:Somebody ---s something | Something ---s something

vverb.contactspread out or open from a closed or folded state

Synset:open spread spread out unfold

Examples:

open the map
spread your arms

Antonyms:fold

Derivationally Related Form:opening

Hypernyms:undo

Inherited Hypernyms:unfoldundochange by reversalchange

Direct Hyponyms:butterflydivaricateexfoliategrasssplayuncross

Full Troponyms:butterflydivaricateexfoliategrasssplayuncross

Sentence Frame:Somebody ---s something | Somebody ---s something PP

vverb.changemake available

Synset:open open up

Examples:

This opens up new possibilities

Derivationally Related Form:opening

Hypernyms:afford give yield

Inherited Hypernyms:openyieldsupplygivetransfer

Causes:open up open

Sentence Frame:Somebody ---s something | Something ---s something

vverb.changebecome available

Synset:open open up

Examples:

an opportunity opened up

Derivationally Related Form:opening

Hypernyms:arise come up

Inherited Hypernyms:openarisehappen

Sentence Frame:Something ---s

vverb.stativehave an opening or passage or outlet

Examples:

The bedrooms open into the hall

Derivationally Related Form:opening

Inherited Hypernyms:open

Sentence Frame:Something is ---ing PP

vverb.competitionmake the opening move

Topic:chesschess game

Examples:

Kasparov opened with a standard opening

Derivationally Related Form:opening

Hypernyms:go move

Inherited Hypernyms:openmove

Sentence Frame:Somebody ---s

vverb.possessionafford access to

Synset:afford give open

Examples:

the door opens to the patio
The French doors give onto a terrace

Derivationally Related Form:openopening

Inherited Hypernyms:afford

Sentence Frame:Something is ---ing PP

vverb.perceptiondisplay the contents of a file or start an application as on a computer

Antonyms:close

Hypernyms:display exhibit expose

Inherited Hypernyms:openexposeshow

Sentence Frame:Somebody ---s something

adjadj.allfirst or beginning

Examples:

the memorable opening bars of Beethoven's Fifth
the play's opening scene

Antonyms:closing

Derivationally Related Form:opening

Inherited Hypernyms:opening

Similar to:beginning first first inaugural initiative initiatory maiden introductory starting

单词	opening
释义	Opening nnoun.objectan open or empty space in or between things Synset:gap Examples: there was a small opening between the trees the explosion made a gap in the wall Derivationally Related Form:gapopen Part Holonyms:Earth's surface surface Hypernyms:space Inherited Hypernyms:openingspaceamorphous shapeshapeattributeabstractionentity Inherited Hypernyms:openingspacelocationobjectphysical entityentity Direct Hyponyms:Ranvier's nodesbreachchasmcleftcrackcrevicediastemafissureforamenhiatusholemouthnodes of Ranvierpocketrentriftripscissuresnagsplittearwindow Full Hyponyms: abyssaperturebolt-holebreachbullet holechapchasmchinkcorner pocketcrackcrannycrevassediastemafatigue crackfaultforamenforamen magnumgerm poregulfholehydathodeinclined faultinterventricular foramenknotholeleaklenticelmicropylemouthnormal faultozone holeperforationpocketpupilranvier's nodesratholeriftripside pocketslitsplitstomastrike-slip faultthrust faultventwindow nnoun.eventa ceremony accompanying the start of some enterprise Derivationally Related Form:open Hypernyms:ceremonial ceremonial occasion ceremony observance Inherited Hypernyms:openingceremonyaffairsocial eventeventpsychological featureabstractionentity nnoun.actbecoming open or being made open Examples: the opening of his arms was the sign I was waiting for Derivationally Related Form:open Hypernyms:change of integrity Inherited Hypernyms:openingchange of integritychangeactionacteventpsychological featureabstractionentity Direct Hyponyms:cutcutting Full Hyponyms: cutepisiotomygastromyincisionlaparoscopylaparotomynephrotomynotchorchotomyperineotomysclerotomyslashthoracotomyvalvotomyvasotomyvenesection nnoun.eventthe first performance (as of a theatrical production) Synset:curtain raising opening night Examples: the opening received good critical reviews Derivationally Related Form:opening Hypernyms:start Inherited Hypernyms:openingstartbeginninghappeningeventpsychological featureabstractionentity nnoun.actthe act of opening something Examples: the ray of light revealed his cautious opening of the door Antonyms:closing Derivationally Related Form:open Hypernyms:motility motion move movement Inherited Hypernyms:openingmotionchangeactionacteventpsychological featureabstractionentity nnoun.stateopportunity especially for employment or promotion Examples: there is an opening in the sales department Derivationally Related Form:open Hypernyms:chance opportunity Inherited Hypernyms:openingopportunitypossibilitybeingstateattributeabstractionentity nnoun.communicationthe initial part of the introduction Examples: the opening established the basic theme Hypernyms:introduction Inherited Hypernyms:openingintroductionsectionmusicauditory communicationcommunicationabstractionentity Inherited Hypernyms:openingintroductionsectionwritingwritten communicationcommunicationabstractionentity Direct Hyponyms:salutationteaser Full Hyponyms: salutationteaser nnoun.cognitiona possible alternative Synset:possibility possible action Examples: bankruptcy is always a possibility Derivationally Related Form:possible Hypernyms:alternative choice option Inherited Hypernyms:possibilityoptiondecision makinghigher cognitive processprocesscognitionpsychological featureabstractionentity Direct Hyponyms:possible Full Hyponyms: possible nnoun.bodyan aperture or hole that opens into a bodily cavity Synset:orifice porta Examples: the orifice into the aorta from the lower left chamber of the heart Derivationally Related Form:open Hypernyms:passage passageway Inherited Hypernyms:orificepassagestructurebody partpartthingphysical entityentity Direct Hyponyms:anusaortic orificeblastoporecardiacervixcervix uteriexternal orificefenestrafontanelfontanelleintroitusmouthnarisosporta hepatispylorusrimasoft spotspiraclestomaurethral orificeuterine cervixvent Full Hyponyms: anterior fontanelleanusaortic orificearsebeakblastoporeblowholecardiacerecervixcytostomefenestrafenestra ovalisfenestra rotundafontanelleimperforate anusincompetent cervixintroitusmouthnarisnostrilosporta hepatisposterior narispudendal cleftpylorusrimarima glottidisrima vestibulisphenoid fontanellespiraclestigmastomatrapurethral orificevent nnoun.artifacta vacant or unobstructed space that is man-made Examples: they left a small opening for the cat at the bottom of the door Hypernyms:artefact artifact Inherited Hypernyms:openingartifactwholeobjectphysical entityentity Direct Hyponyms:aperturebellbreechcrackembrasureexitfenestellaflyfly frontgapgrillegun muzzleholeinletintakeintersticeissuelatticelunettemouthmuzzleneckneck openingoutletpass-throughportportholerear of barrelrear of tubeslitspoutthroatway outwicketwindow Full Hyponyms: air holeair hornaperturearmholebellbreechbungholebuttonholecar windowcoin slotcountersinkcrew neckcupdecolletageear holeexiteyeeyeletfinger holeflygapgargoylegun muzzlehawseholeintakeintersticejagjudaskeyholelacunaloopholelubber's holelunettemail slotmanholemortisemouthmouth holemouthpiecenail holenecknecklinenozzleoutfallpass-throughpeepholeperforationpinholepinprickplugholepointportpostholepuncturequarterlightrear windowshowerheadsiameseslitslotsmoke holesound holespark gapspoutthroatthumbholeticket windowv neckventwicketwindow nnoun.artifactan entrance equipped with a hatch; especially a passageway between decks of a ship Synset:hatchway scuttle Derivationally Related Form:open Hypernyms:entrance entranceway entree entry entryway Inherited Hypernyms:hatchwayentranceaccesswayartifactwholeobjectphysical entityentity Direct Hyponyms:escape hatch Part Meronyms:hatch Full Hyponyms: escape hatch nnoun.acta recognized sequence of moves at the beginning of a game of chess Topic:chesschess game Synset:chess opening Examples: he memorized all the important chess openings Hypernyms:sequence succession Inherited Hypernyms:openingsuccessionorderorganizationactivityacteventpsychological featureabstractionentity nnoun.actthe first of a series of actions Synset:first step initiative opening move Derivationally Related Form:openopening Hypernyms:beginning commencement start Inherited Hypernyms:first stepbeginningchange of statechangeactionacteventpsychological featureabstractionentity Direct Hyponyms:curtain raiserfirst basepeace initiative Full Hyponyms: curtain raiserfirst basepeace initiative vverb.contactcause to open or to become open Synset:open open up Examples: Mary opened the car door Antonyms:close Derivationally Related Form:openingopener Inherited Hypernyms:open Direct Hyponyms:breachbreak openclick opengapjimmylanceleverpriseprizepryreopenunbarunboltuncorkunlockunseal Causes:open up open Full Troponyms:break openclick opengaplancepryreopenunbarunboltuncorkunlockunseal Sentence Frame:Somebody ---s something \| Something ---s something \| They want to --- the doors (apply to: open, open up) vverb.socialstart to operate or function or cause to start operating or functioning Synset:open open up Examples: open a business Antonyms:close Derivationally Related Form:opening Inherited Hypernyms:open Direct Hyponyms:establishfoundlaunchset up Full Troponyms:establish Sentence Frame:Somebody ---s something \| Something ---s \| The business is going to --- (apply to: open, open up) vverb.contactbecome open Synset:open open up Examples: The door opened Antonyms:close Derivationally Related Form:opening Hypernyms:change state turn Inherited Hypernyms:openchange statechange Direct Hyponyms:fly openunfasten Full Troponyms:fly openunfasten Sentence Frame:Something ---s \| The doors --- (apply to: open, open up) vverb.socialbegin or set in action, of meetings, speeches, recitals, etc. Examples: He opened the meeting with a long speech Antonyms:close Derivationally Related Form:openingopener Hypernyms:commence embark on start start up Inherited Hypernyms:openstartbegin Direct Hyponyms:call to orderinaugurate Full Troponyms:call to orderinaugurate Sentence Frame:Somebody ---s something \| Something ---s something vverb.contactspread out or open from a closed or folded state Synset:open spread spread out unfold Examples: open the map spread your arms Antonyms:fold Derivationally Related Form:opening Hypernyms:undo Inherited Hypernyms:unfoldundochange by reversalchange Direct Hyponyms:butterflydivaricateexfoliategrasssplayuncross Full Troponyms:butterflydivaricateexfoliategrasssplayuncross Sentence Frame:Somebody ---s something \| Somebody ---s something PP vverb.changemake available Synset:open open up Examples: This opens up new possibilities Derivationally Related Form:opening Hypernyms:afford give yield Inherited Hypernyms:openyieldsupplygivetransfer Causes:open up open Sentence Frame:Somebody ---s something \| Something ---s something vverb.changebecome available Synset:open open up Examples: an opportunity opened up Derivationally Related Form:opening Hypernyms:arise come up Inherited Hypernyms:openarisehappen Sentence Frame:Something ---s vverb.stativehave an opening or passage or outlet Examples: The bedrooms open into the hall Derivationally Related Form:opening Inherited Hypernyms:open Sentence Frame:Something is ---ing PP vverb.competitionmake the opening move Topic:chesschess game Examples: Kasparov opened with a standard opening Derivationally Related Form:opening Hypernyms:go move Inherited Hypernyms:openmove Sentence Frame:Somebody ---s vverb.possessionafford access to Synset:afford give open Examples: the door opens to the patio The French doors give onto a terrace Derivationally Related Form:openopening Inherited Hypernyms:afford Sentence Frame:Something is ---ing PP vverb.perceptiondisplay the contents of a file or start an application as on a computer Antonyms:close Hypernyms:display exhibit expose Inherited Hypernyms:openexposeshow Sentence Frame:Somebody ---s something adjadj.allfirst or beginning Examples: the memorable opening bars of Beethoven's Fifth the play's opening scene Antonyms:closing Derivationally Related Form:opening Inherited Hypernyms:opening Similar to:beginning first first inaugural initiative initiatory maiden introductory starting
随便看	cypripedium acaule cypripedium album cypripedium arietinum cypripedium calceolus cypripedium calceolus pubescens cypripedium californicum cypripedium fasciculatum cypripedium montanum cypripedium parviflorum cypripedium reginae cyproheptadine cyprus cyrano de bergerac cyril cyril burt cyrilla cyrilla family cyrilla racemiflora cyrilliaceae cyrillic cyrillic alphabet cyril lodowic burt cyril northcote parkinson cyrtomium cyrtomium aculeatum