英语词汇“leaving”的英英意思、用法、释义、翻译、读音、例句、短语、词组-英语词典

Leaving

nnoun.actthe act of departing

Synset:departure going going away

Derivationally Related Form:godepart

Hypernyms:act deed human action human activity

Inherited Hypernyms:departureacteventpsychological featureabstractionentity

Direct Hyponyms:French leaveboardingbreaking awaydespatchdisappearancedisappearingdispatchembarkationembarkmentexitfarewellleaveleave-takingpartingsailingshipmenttakeoffwithdrawal

Full Hyponyms:

vverb.motiongo away from a place

Synset:go away go forth leave

Examples:

At what time does your train leave?
She didn't leave until midnight
The ship leaves at midnight

Antonyms:arrive

Derivationally Related Form:leaveleaver

Inherited Hypernyms:leave

Direct Hyponyms:abandonbeetle offboltbolt outbreak awaybugger offbunkbuzz offcome awaydecampdepartdesertemptyescapefly the coopfuck offgetget outgo outhead for the hillshightail itlamlingerpartpop offpull outquitride awayride offrunrun awayrun offrun outrush awayrush offscarperscatscramset forthset offset outskipslip awaysneak awaysneak offsneak outstartstart outsteal awaytake leavetake offtake to the woodstarryturn tailvacatevamoosewalk awaywalk offwalk out

Full Troponyms:abscondbeat a retreatblazebreakcome awaycongeedatedecampdefectdepartdesertdouble-dateelopeeludeescapeexfiltratefleego outhigh-taillevantplump outpop offpull outratride offroar offrun awayrun offrush offsally forthscatscramshakeskedaddleslipslip awaystampedetake offtarryvacatewalk offwalk outwalk out of

Sentence Frame:Something ---s | Somebody ---s | John will --- angry (apply to: leave) | Sam and Sue --- (apply to: go away)

vverb.cognitiongo and leave behind, either intentionally or by neglect or forgetfulness

Examples:

She left a mess when she moved out
His good luck finally left him
her husband left her after 20 years of marriage
she wept thinking she had been left behind

Derivationally Related Form:leave

Inherited Hypernyms:leave

Direct Hyponyms:abandondesertdesolateforsakejilt

Full Troponyms:abandonditchexposejiltmaroonwalk out

Sentence Frame:Somebody ---s something | Somebody ---s somebody | Something ---s somebody | They --- the people the food (apply to: leave) | They --- the money in the closet (apply to: leave)

vverb.stativeact or be so as to become in a specified state

Examples:

The inflation left them penniless
The president's remarks left us speechless

Hypernyms:get make

Inherited Hypernyms:leavemakechange

Sentence Frame:Something ---s somebody | Something ---s something Adjective/Noun

vverb.changeleave unchanged or undisturbed or refrain from taking

Synset:leave leave alone leave behind let alone

Examples:

leave it as is
leave the young fawn alone
leave the flowers that you see in the park behind

Hypernyms:forbear refrain

Inherited Hypernyms:leaverefrain

Direct Hyponyms:let

Full Troponyms:let

vverb.motionmove out of or depart from

Synset:exit get out go out leave

Examples:

leave the room
the fugitive has left the country

Antonyms:enter

Derivationally Related Form:leaveexit

Hypernyms:move

Inherited Hypernyms:exitmove

Direct Hyponyms:departejectfall outfile outget offgogo awayhop outlog offlog outpop outstep outundock

Full Troponyms:deplanedetrainejectfall outfile outget offgohop outlog outpop outshove offstep outundock

Sentence Frame:Somebody ---s something | Something ---s | Somebody ---s | Something ---s something | The men --- the boat (apply to: leave, exit)

vverb.stativemake a possibility or provide opportunity for; permit to be attainable or cause to remain

Synset:allow allow for leave provide

Examples:

This leaves no room for improvement
The evidence allows only one conclusion
allow for mistakes
leave lots of time for the trip
This procedure provides for lots of leeway

Hypernyms:afford give yield

Inherited Hypernyms:leaveyieldsupplygivetransfer

Sentence Frame:Somebody ---s something | Something ---s something | Somebody ---s PP (apply to: provide)

vverb.stativeproduce as a result or residue

Synset:lead leave result

Examples:

The water left a mark on the silk dress
Her blood left a stain on the napkin

Derivationally Related Form:resultantresult

Hypernyms:bring about give rise produce

Inherited Hypernyms:leaveproducemake

Direct Hyponyms:lead

Full Troponyms:entailleadnecessitate

Sentence Frame:Something ---s something

vverb.socialremove oneself from an association with or participation in

Synset:depart leave pull up stakes

Examples:

She wants to leave
The teenager left home
She left her position with the Red Cross
He left the Senate after two terms
after 20 years with the same company, she pulled up stakes

Hypernyms:change

Inherited Hypernyms:leavechange

Direct Hyponyms:drop outleave officequitresignstep down

Full Troponyms:abdicatebow outdrop outfallleave officeretiresuperannuatetop outvacate

Sentence Frame:Somebody ---s something | Somebody ---s | They --- the countryside (apply to: leave)

vverb.possessionput into the care or protection of someone

Synset:entrust leave

Examples:

He left the decision to his deputy
leave your child in the nurse's care

Hypernyms:give hand pass pass on reach turn over

Inherited Hypernyms:entrustpasstransfer

Sentence Frame:Somebody ---s something to somebody | They --- the money to them (apply to: leave, entrust) | They --- them the money (apply to: leave, entrust)

vverb.possessionleave or give by will after one's death

Synset:bequeath leave will

Examples:

My aunt bequeathed me all her jewelry
My grandfather left me his entire estate

Antonyms:disinherit

Derivationally Related Form:will

Hypernyms:gift give present

Inherited Hypernyms:bequeathgive

Direct Hyponyms:deviseentailfee-tailpass onremember

Full Troponyms:devisefee-tailhand downpass onpropagateremember

Sentence Frame:Somebody ---s somebody something | Somebody ---s something to somebody | They --- the money to them (apply to: bequeath, will, leave) | They --- them the money (apply to: bequeath, will, leave)

vverb.stativehave left or have as a remainder

Examples:

That left the four of us
19 minus 8 leaves 11

Hypernyms:have

Inherited Hypernyms:leavehave

Sentence Frame:Something ---s somebody | Something ---s something

vverb.changebe survived by after one's death

Synset:leave leave behind

Examples:

He left six children
At her death, she left behind her husband and 11 cats

Inherited Hypernyms:leave

Direct Hyponyms:widow

Entailment:buy the farm cash in one's chips choke conk croak decease die drop dead exit expire give-up the ghost go kick the bucket pass away pass perish pop off snuff it

Full Troponyms:widow

Sentence Frame:Somebody ---s somebody | Sam cannot --- Sue (apply to: leave)

vverb.possessiontransmit (knowledge or skills)

Synset:give impart leave pass on

Examples:

give a secret to the Russians
leave your name and address here
impart a new skill to the students

Derivationally Related Form:impartinggivingimpartation

Hypernyms:tell

Inherited Hypernyms:imparttellinformcommunicateinteractact

Direct Hyponyms:convey

Full Troponyms:acknowledgeaimalludeappreciateaskbackgroundbeambear downbodybreathebring outburst outclue inconnoteconveydogmatizedrivedrive homeembodyexemplifyexpressexudeflashforegroundformularizeframegivegive voicehintimplyincriminateintimatelexicalizelookmake outmeanmenacepick uppoint uppresupposeraisere-emphasiserip outsaysignifysmacksmilesneersoft-pedalspellstresssuggestthanktopicalizetypifyunderscoreventwave off

Sentence Frame:Somebody ---s something | Somebody ---s something to somebody | They won't --- the story (apply to: pass on)

vverb.cognitionleave behind unintentionally

Synset:forget leave

Examples:

I forgot my umbrella in the restaurant
I left my keys inside the car and locked the doors

Hypernyms:lose

Inherited Hypernyms:forgetlose

Sentence Frame:Somebody ---s something | Somebody ---s somebody | Somebody ---s something PP | They --- the money in the closet (apply to: forget, leave)

单词	leaving
释义	Leaving nnoun.actthe act of departing Synset:departure going going away Derivationally Related Form:godepart Hypernyms:act deed human action human activity Inherited Hypernyms:departureacteventpsychological featureabstractionentity Direct Hyponyms:French leaveboardingbreaking awaydespatchdisappearancedisappearingdispatchembarkationembarkmentexitfarewellleaveleave-takingpartingsailingshipmenttakeoffwithdrawal Full Hyponyms: abscondmentabsence without leaveboardingbreaking awaydecampmentdesertiondeviationismdisappearancedisengagementdispatcheffacementevacuationexitfarewellfrench leavemedical evacuationpullbackrecedingreshipmentretirementretreatsailingtakeoffvaledictionvanishingwithdrawal vverb.motiongo away from a place Synset:go away go forth leave Examples: At what time does your train leave? She didn't leave until midnight The ship leaves at midnight Antonyms:arrive Derivationally Related Form:leaveleaver Inherited Hypernyms:leave Direct Hyponyms:abandonbeetle offboltbolt outbreak awaybugger offbunkbuzz offcome awaydecampdepartdesertemptyescapefly the coopfuck offgetget outgo outhead for the hillshightail itlamlingerpartpop offpull outquitride awayride offrunrun awayrun offrun outrush awayrush offscarperscatscramset forthset offset outskipslip awaysneak awaysneak offsneak outstartstart outsteal awaytake leavetake offtake to the woodstarryturn tailvacatevamoosewalk awaywalk offwalk out Full Troponyms:abscondbeat a retreatblazebreakcome awaycongeedatedecampdefectdepartdesertdouble-dateelopeeludeescapeexfiltratefleego outhigh-taillevantplump outpop offpull outratride offroar offrun awayrun offrush offsally forthscatscramshakeskedaddleslipslip awaystampedetake offtarryvacatewalk offwalk outwalk out of Sentence Frame:Something ---s \| Somebody ---s \| John will --- angry (apply to: leave) \| Sam and Sue --- (apply to: go away) vverb.cognitiongo and leave behind, either intentionally or by neglect or forgetfulness Examples: She left a mess when she moved out His good luck finally left him her husband left her after 20 years of marriage she wept thinking she had been left behind Derivationally Related Form:leave Inherited Hypernyms:leave Direct Hyponyms:abandondesertdesolateforsakejilt Full Troponyms:abandonditchexposejiltmaroonwalk out Sentence Frame:Somebody ---s something \| Somebody ---s somebody \| Something ---s somebody \| They --- the people the food (apply to: leave) \| They --- the money in the closet (apply to: leave) vverb.stativeact or be so as to become in a specified state Examples: The inflation left them penniless The president's remarks left us speechless Hypernyms:get make Inherited Hypernyms:leavemakechange Sentence Frame:Something ---s somebody \| Something ---s something Adjective/Noun vverb.changeleave unchanged or undisturbed or refrain from taking Synset:leave leave alone leave behind let alone Examples: leave it as is leave the young fawn alone leave the flowers that you see in the park behind Hypernyms:forbear refrain Inherited Hypernyms:leaverefrain Direct Hyponyms:let Full Troponyms:let Sentence Frame:Somebody ---s somebody PP \| Somebody ---s something PP \| Somebody ---s something \| Somebody ---s somebody \| Something ---s somebody \| Something ---s something vverb.motionmove out of or depart from Synset:exit get out go out leave Examples: leave the room the fugitive has left the country Antonyms:enter Derivationally Related Form:leaveexit Hypernyms:move Inherited Hypernyms:exitmove Direct Hyponyms:departejectfall outfile outget offgogo awayhop outlog offlog outpop outstep outundock Full Troponyms:deplanedetrainejectfall outfile outget offgohop outlog outpop outshove offstep outundock Sentence Frame:Somebody ---s something \| Something ---s \| Somebody ---s \| Something ---s something \| The men --- the boat (apply to: leave, exit) vverb.stativemake a possibility or provide opportunity for; permit to be attainable or cause to remain Synset:allow allow for leave provide Examples: This leaves no room for improvement The evidence allows only one conclusion allow for mistakes leave lots of time for the trip This procedure provides for lots of leeway Hypernyms:afford give yield Inherited Hypernyms:leaveyieldsupplygivetransfer Sentence Frame:Somebody ---s something \| Something ---s something \| Somebody ---s PP (apply to: provide) vverb.stativeproduce as a result or residue Synset:lead leave result Examples: The water left a mark on the silk dress Her blood left a stain on the napkin Derivationally Related Form:resultantresult Hypernyms:bring about give rise produce Inherited Hypernyms:leaveproducemake Direct Hyponyms:lead Full Troponyms:entailleadnecessitate Sentence Frame:Something ---s something vverb.socialremove oneself from an association with or participation in Synset:depart leave pull up stakes Examples: She wants to leave The teenager left home She left her position with the Red Cross He left the Senate after two terms after 20 years with the same company, she pulled up stakes Hypernyms:change Inherited Hypernyms:leavechange Direct Hyponyms:drop outleave officequitresignstep down Full Troponyms:abdicatebow outdrop outfallleave officeretiresuperannuatetop outvacate Sentence Frame:Somebody ---s something \| Somebody ---s \| They --- the countryside (apply to: leave) vverb.possessionput into the care or protection of someone Synset:entrust leave Examples: He left the decision to his deputy leave your child in the nurse's care Hypernyms:give hand pass pass on reach turn over Inherited Hypernyms:entrustpasstransfer Sentence Frame:Somebody ---s something to somebody \| They --- the money to them (apply to: leave, entrust) \| They --- them the money (apply to: leave, entrust) vverb.possessionleave or give by will after one's death Synset:bequeath leave will Examples: My aunt bequeathed me all her jewelry My grandfather left me his entire estate Antonyms:disinherit Derivationally Related Form:will Hypernyms:gift give present Inherited Hypernyms:bequeathgive Direct Hyponyms:deviseentailfee-tailpass onremember Full Troponyms:devisefee-tailhand downpass onpropagateremember Sentence Frame:Somebody ---s somebody something \| Somebody ---s something to somebody \| They --- the money to them (apply to: bequeath, will, leave) \| They --- them the money (apply to: bequeath, will, leave) vverb.stativehave left or have as a remainder Examples: That left the four of us 19 minus 8 leaves 11 Hypernyms:have Inherited Hypernyms:leavehave Sentence Frame:Something ---s somebody \| Something ---s something vverb.changebe survived by after one's death Synset:leave leave behind Examples: He left six children At her death, she left behind her husband and 11 cats Inherited Hypernyms:leave Direct Hyponyms:widow Entailment:buy the farm cash in one's chips choke conk croak decease die drop dead exit expire give-up the ghost go kick the bucket pass away pass perish pop off snuff it Full Troponyms:widow Sentence Frame:Somebody ---s somebody \| Sam cannot --- Sue (apply to: leave) vverb.possessiontransmit (knowledge or skills) Synset:give impart leave pass on Examples: give a secret to the Russians leave your name and address here impart a new skill to the students Derivationally Related Form:impartinggivingimpartation Hypernyms:tell Inherited Hypernyms:imparttellinformcommunicateinteractact Direct Hyponyms:convey Full Troponyms:acknowledgeaimalludeappreciateaskbackgroundbeambear downbodybreathebring outburst outclue inconnoteconveydogmatizedrivedrive homeembodyexemplifyexpressexudeflashforegroundformularizeframegivegive voicehintimplyincriminateintimatelexicalizelookmake outmeanmenacepick uppoint uppresupposeraisere-emphasiserip outsaysignifysmacksmilesneersoft-pedalspellstresssuggestthanktopicalizetypifyunderscoreventwave off Sentence Frame:Somebody ---s something \| Somebody ---s something to somebody \| They won't --- the story (apply to: pass on) vverb.cognitionleave behind unintentionally Synset:forget leave Examples: I forgot my umbrella in the restaurant I left my keys inside the car and locked the doors Hypernyms:lose Inherited Hypernyms:forgetlose Sentence Frame:Somebody ---s something \| Somebody ---s somebody \| Somebody ---s something PP \| They --- the money in the closet (apply to: forget, leave)
随便看	categoreme categorial categoric categorical categorical imperative categorically categorisation categorise categorised categorization categorize categorized category catena catenary catenate catenulate cater catercorner cater-cornered caterer catering caterpillar caterpillar track caterpillar-tracked