请输入您要查询的英文单词:

 

单词 setting
释义
Setting
nnoun.locationthe context and environment in which something is set
Synset:scene
Examples:
  • the perfect setting for a ghost story
Hypernyms:environment environs surround surroundings
Inherited Hypernyms:settingenvironmentgeographical arearegionlocationobjectphysical entityentity
Direct Hyponyms:scenario
Full Hyponyms:
scenario
nnoun.statethe state of the environment in which a situation exists
Synset:background scope
Examples:
  • you can't do that in a university setting
Derivationally Related Form:scopal
Hypernyms:environment
Inherited Hypernyms:settingenvironmentsituationstateattributeabstractionentity
Direct Hyponyms:canvascanvassshow windowshowcase
Full Hyponyms:
canvasshowcase
nnoun.artifactarrangement of scenery and properties to represent the place where a play or movie is enacted
Synset:mise en scene stage setting
Hypernyms:stage
Inherited Hypernyms:mise en scenestageplatformhorizontal surfacesurfaceartifactwholeobjectphysical entityentity
Part Meronyms:flat prop property set stage set
nnoun.statethe set of facts or circumstances that surround a situation or event
Synset:circumstance context
Examples:
  • the historical context
Derivationally Related Form:circumstantialcontextual
Hypernyms:environment
Inherited Hypernyms:contextenvironmentsituationstateattributeabstractionentity
Direct Hyponyms:conditions
Full Hyponyms:
conditions
nnoun.locationthe physical position of something
Examples:
  • he changed the setting on the thermostat
Derivationally Related Form:set
Hypernyms:place position
Inherited Hypernyms:settingpositionpointlocationobjectphysical entityentity
nnoun.artifacta table service for one person
Synset:place setting
Examples:
  • a place setting of sterling flatware
Derivationally Related Form:set
Hypernyms:service table service
Inherited Hypernyms:place settingservicetablewarewarearticleartifactwholeobjectphysical entityentity
nnoun.artifacta mounting consisting of a piece of metal (as in a ring or other jewelry) that holds a gem in place
Synset:mount
Examples:
  • the diamond was in a plain gold mount
Derivationally Related Form:mountset
Hypernyms:mounting
Inherited Hypernyms:mountmountingframeworksupporting structurestructureartifactwholeobjectphysical entityentity
Direct Hyponyms:pave
Full Hyponyms:
pave
vverb.contactput into a certain place or abstract location
Synset:lay place pose position put set
Examples:
  • Put your things here
  • Set the tray down
  • Set the dogs on the scent of the missing children
  • Place emphasis on a certain point
Derivationally Related Form:placementpositionersetplacepositionsetting
Hypernyms:displace move
Inherited Hypernyms:putmove
Direct Hyponyms:apposearrangebarrelbedbottlebucketbuttclapcockcoffincramdepositdisposedocketemplaceencloseensconcefixglyceroliseglycerolizegroundimbricateincloseinsertinstalinstallintersperseintroducejarjuxtaposeladlelaylay overleanloadmarshalmiddlemisplacenestleparallelizeparkperchpigeonholepilepillowplace downplace uprightplantpoisepositpositionpostposepreposeput backput downput inrack uprecessreclinereplacereposerepositionrestseatseedsetset downset upsettlesettle downshelveshipsignsiphonsitsit downsituatesnugglesowspacestandstand upstepstick instratifysuperimposesuperposeteetee upthrowthrusttrenchunderlayupend
Full Troponyms:addressafforestaimalphabetizeapposearrangebarrelbeadbedblowbottlebroadcastbucketburybuttcascadecatenatecatheterizechainchargecheckrowclapcockcodifycoffincollatecompartconcatenateconcordcordcorralcovercramcupdeclaredeploydevelopdibbledigestdisentangledisposedocketdrapedraw a bead ondressemplaceensconceevenfeedfoistgglassglycerolizegradategroundhang upholdhousecleanimbricateinjectinoculateinseminateinsertinsetinstallinterleaveinterlockintersperseinterstratifyjamjarjuxtaposeladlelayleanlevelline uploadmakemarshalmiddlemisplacenestleorderorganizeorientoverstuffpackpadpairparallelizeparkperchpigeonholepilepillowpitchplankplantplayplugpoisepoppositionpostpostposepreenpreposepuddlepyramidrack uprailrangerange inratravelre-afforestrearrangereburyrecessreclinerecodereducereforestregularizereinstallreplacereplantreposerepositionreseatreshipreshufflerestrestructureretrofitrickrootscatterseatsedimentseedserializesetset downsettleshelveshipsightsignsiphonsituateslipsowspacespatspawnspring-cleansquaresquare upstackstaggerstandstemstepstraightenstratifystringstring outstructurestuffsuperimposesuperposeswingsystematizetargetteaseteethrowtidytreetrenchturnunderlayupendwire
Sentence Frame:Somebody ---s something PP | They --- the bags on the table (apply to: pose, set, place, position, put, lay)
vverb.cognitionfix conclusively or authoritatively
Synset:determine set
Examples:
  • set the rules
Derivationally Related Form:determinationset
Inherited Hypernyms:determine
Direct Hyponyms:assesschargedatefiliateformatidentifyinitialiseinitializeplacepricetaxvalue
Full Troponyms:chargechronologizecloistercontradistinguishcontrastdatedecoupledemarcatedisadvantagediscriminatedistinguishfiliatefloatformatghettoizehandicaphave the distinctionhive offidentifyindividualizeinitializeisolateknowlabellosemark upmaroonmisdateoverpriceovervaluepostdatepredateprejudicepricequarantineredlinerigsecludesegregateseveralizesexstratifysubtilizetaxunderquoteundervaluevalue
Sentence Frame:Somebody ---s something | Somebody ---s to somebody | Somebody ---s that CLAUSE | Something ---s something
vverb.communicationdecide upon or fix definitely
Synset:define determine fix limit set specify
Examples:
  • fix the variables
  • specify the parameters
Derivationally Related Form:determinersetlimitdeterminant
Hypernyms:choose pick out select take
Inherited Hypernyms:specifychoosedecide
Direct Hyponyms:definenamequantifyreset
Full Troponyms:definenamequantifyredefinereset
Sentence Frame:Somebody ---s something
vverb.communicationestablish as the highest level or best performance
Synset:mark set
Examples:
  • set a record
Derivationally Related Form:mark
Hypernyms:establish lay down make
Inherited Hypernyms:setlay downmake
Sentence Frame:Somebody ---s something | Something ---s something
vverb.changeput into a certain state; cause to be in a certain state
Examples:
  • set the house afire
Hypernyms:alter change modify
Inherited Hypernyms:setchange
Direct Hyponyms:keynotepitch
Full Troponyms:keynotepitch
Sentence Frame:Something ---s something Adjective/Noun | Somebody ---s something PP
vverb.contactfix in a border
Examples:
  • The goldsmith set the diamond
Derivationally Related Form:settingset
Hypernyms:arrange set up
Inherited Hypernyms:setarrangeputmove
Sentence Frame:Somebody ---s something
vverb.changemake ready or suitable or equip in advance for a particular purpose or for some use, event, etc
Synset:fix gear up prepare ready set set up
Examples:
  • Get the children ready for school!
  • prepare for war
  • I was fixing to leave town after I paid the hotel bill
Derivationally Related Form:readyingpreparatorypreparationsetreadypreparative
Hypernyms:alter change modify
Inherited Hypernyms:fixchange
Direct Hyponyms:bracecramcropcultivatefixlay outmountpoisepreconditionprimeprovidesetset upsocialisesocializesummerisesummerizewinterisewinterizework
Full Troponyms:bracecramcultivatefixmountovercroppreconditionprimeprovideset upsocializesteelsummerizewinterize
Sentence Frame:Somebody ---s somebody PP | Somebody ---s something PP | Somebody ---s something | Somebody ---s somebody | Something ---s somebody | Something ---s something | Somebody ---s to INFINITIVE | Somebody ---s (apply to: prepare, gear up)
vverb.changeset to a certain position or cause to operate correctly
Examples:
  • set clocks or instruments
Derivationally Related Form:setting
Hypernyms:adjust correct set
Inherited Hypernyms:setadjustchange
Direct Hyponyms:advanceresetset ahead
Full Troponyms:advancereset
Sentence Frame:Somebody ---s something
vverb.creationlocate
Synset:localise localize place set
Examples:
  • The film is set in Africa
Derivationally Related Form:setplaceplacementlocalizationlocale
Hypernyms:present represent stage
Inherited Hypernyms:setstagere-createmake
Sentence Frame:Somebody ---s something PP
vverb.motiondisappear beyond the horizon
Topic:astronomyuranology
Synset:go down go under set
Examples:
  • the sun sets early these days
Antonyms:rise
Hypernyms:come down descend fall go down
Inherited Hypernyms:setdescendtravel
Sentence Frame:Something ---s | The moon will soon --- (apply to: go down, go under, set)
vverb.creationadapt for performance in a different way
Topic:music
Synset:arrange set
Examples:
  • set this poem to music
Derivationally Related Form:arranger
Hypernyms:compose write
Inherited Hypernyms:arrangecomposemake
Direct Hyponyms:prearrangeputtabletabularisetabularizetabulatetranspose
Full Troponyms:prearrangeputtabletranspose
Sentence Frame:Somebody ---s something | Did he --- his major works over a short period of time? (apply to: set, arrange)
vverb.contactput or set (seeds, seedlings, or plants) into the ground
Synset:plant set
Examples:
  • Let's plant flowers in the garden
Derivationally Related Form:plantplantingplanterset
Hypernyms:lay place pose position put set
Inherited Hypernyms:plantputmove
Direct Hyponyms:afforestbedcheckrowdibbleforestpuddlereplantroottree
Full Troponyms:afforestbedcheckrowdibblepuddlere-afforestreforestreplantroottree
Sentence Frame:Somebody ---s something | They --- rye in the field (apply to: plant)
vverb.creationapply or start
Examples:
  • set fire to a building
Hypernyms:initiate originate start
Inherited Hypernyms:setoriginatemake
Sentence Frame:Somebody ---s something
vverb.changebecome gelatinous
Synset:congeal jell set
Examples:
  • the liquid jelled after we added the enzyme
Derivationally Related Form:setcongelation
Hypernyms:solidify
Inherited Hypernyms:jellsolidifychange integritychange
Sentence Frame:Something ---s
vverb.creationset in type
Synset:set typeset
Examples:
  • My book will be typeset nicely
  • set these words in italics
Derivationally Related Form:typesetter
Hypernyms:impress print
Inherited Hypernyms:typesetprintwritetracemarkchange
Sentence Frame:Somebody ---s something
vverb.contactput into a position that will restore a normal state
Examples:
  • set a broken bone
Derivationally Related Form:set
Hypernyms:lay place pose position put set
Inherited Hypernyms:setputmove
Sentence Frame:Somebody ---s something | Did he --- his foot? (apply to: set)
vverb.contactinsert (a nail or screw below the surface, as into a countersink)
Synset:countersink set
Derivationally Related Form:countersink
Hypernyms:bury sink
Inherited Hypernyms:setburyimplantinsertattachconnect
Sentence Frame:Somebody ---s something
vverb.contactgive a fine, sharp edge to a knife or razor
Hypernyms:hone
Inherited Hypernyms:sethonesharpenchange
Sentence Frame:Somebody ---s something
vverb.competitionurge to attack someone
Synset:set sic
Examples:
  • The owner sicked his dogs on the intruders
  • the shaman sics sorcerers on the evil spirits
Hypernyms:assail assault attack set on
Inherited Hypernyms:sicassail
Sentence Frame:Somebody ---s something on somebody
vverb.cognitionestimate
Synset:place put set
Examples:
  • We put the time of arrival at 8 P.M.
Hypernyms:approximate estimate gauge guess judge
Inherited Hypernyms:placeestimatecalculatereasonthink
Sentence Frame:Somebody ---s something
vverb.changeequip with sails or masts
Synset:rig set set up
Examples:
  • rig a ship
Derivationally Related Form:riggerriggingrig
Hypernyms:equip fit fit out outfit
Inherited Hypernyms:rigequipsupplygivetransfer
Sentence Frame:Somebody ---s something
vverb.changeget ready for a particular purpose or event
Synset:lay out set set up
Examples:
  • set up an experiment
  • set the table
  • lay out the tools for the surgery
Derivationally Related Form:settingset
Hypernyms:fix gear up prepare ready set set up
Inherited Hypernyms:set upfixchange
Sentence Frame:Somebody ---s something
vverb.changealter or regulate so as to achieve accuracy or conform to a standard
Synset:adjust correct set
Examples:
  • Adjust the clock, please
  • correct the alignment of the front wheels
Derivationally Related Form:adjustableadjustmentcorrectiveadjustiveadjuster
Hypernyms:alter change modify
Inherited Hypernyms:adjustchange
Direct Hyponyms:alignattunecalibratecitifycoordinatedecompressdepressurisedepressurizefine-tunefitfocalisefocalizefocusgraduateharmoniseharmonizejustifylineariselinearizematchmodulateordinateplumbpressurisepressurizeproportionreadjustreconcileregulateresetsetsharpensyncsynchronisesynchronizetempertimetrimtunetune upzerozero in
Full Troponyms:advancealignattunebalancecalibratecancelcarrycitifycompensatecomplementcounteractcoverdepressurizefine-tunefocusharmonizejustifykeylinearizematchmisalignmodulateoffsetoverridephaseplumbpressurizeproportionpuncturereadjustrefocusregulateresetscale downscale upservicesetsynchronizetempertimetrimtunetune inzero
Sentence Frame:Somebody ---s something | Something ---s something | Somebody ---s something PP
vverb.bodybear fruit
Synset:fructify set
Examples:
  • the apple trees fructify
Derivationally Related Form:fruitfructification
Hypernyms:multiply procreate reproduce
Inherited Hypernyms:fructifyreproducemake
Sentence Frame:Something ---s
vverb.bodyarrange attractively
Synset:arrange coif coiffe coiffure do dress set
Examples:
  • dress my hair for the wedding
Derivationally Related Form:arrangementcoiffure
Hypernyms:groom neaten
Inherited Hypernyms:dressgroomfancifybetterchange
Direct Hyponyms:bobwave
Full Troponyms:bobgauffermarcelpermwave
Sentence Frame:Somebody ---s something | They --- their hair (apply to: set, coiffure, coif, do, dress, arrange, coiffe)
随便看

 

英语词典包含147479条英英释义在线翻译词条,基本涵盖了全部常用单词的英英翻译及用法,是英语学习的有利工具。

 

Copyright © 2004-2022 Newdu.com All Rights Reserved
更新时间:2026/4/2 14:17:20