英语词汇“set”的英英意思、用法、释义、翻译、读音、例句、短语、词组-英语词典

Set

nnoun.groupa group of things of the same kind that belong together and are so used

Examples:

a set of books
a set of golf clubs
a set of teeth

Hypernyms:accumulation aggregation assemblage collection

Inherited Hypernyms:setcollectiongroupabstractionentity

Direct Hyponyms:Cartesian productbracebracketchess setchoirconjugationconsortcorecore groupdentitionfieldintersectionjoinmanicure setnucleusoctetoctettepairportfolioproductquadruplequadrupletquartetquartettequintetquintettequintuplequintupletscoreseptetseptettesestetsextetsextettesingletonsuitesumsynsetteeththreescoretriadtriotripletripletunion

Member Meronyms:volume

Full Hyponyms:

nnoun.group(mathematics) an abstract collection of numbers or symbols

Topic:mathmathematicsmaths

Examples:

the set of prime numbers is infinite

Hypernyms:abstract entity abstraction

Inherited Hypernyms:setabstractionentity

Direct Hyponyms:Mandelbrot setdiagonaldomaindomain of a functionfieldgroupimageintersectionintervallocusmathematical groupmathematical spacenull setrangerange of a functionrootsolutionsubsettopological spaceuniversal set

Full Hyponyms:

nnoun.actseveral exercises intended to be done in series

Synset:exercise set

Examples:

he did four sets of the incline bench press

Hypernyms:exercise exercising physical exercise physical exertion workout

Inherited Hypernyms:setexerciseeffortlaborworkactivityacteventpsychological featureabstractionentity

nnoun.artifactrepresentation consisting of the scenery and other properties used to identify the location of a dramatic production

Synset:stage set

Examples:

the sets were meticulously authentic

Part Holonyms:mise en scene setting stage setting

Hypernyms:representation

Inherited Hypernyms:stage setrepresentationcreationartifactwholeobjectphysical entityentity

Direct Hyponyms:scenescenery

Part Meronyms:set decoration

Full Hyponyms:

nnoun.groupan unofficial association of people or groups

Synset:band circle lot

Examples:

the smart set goes there
they were an angry lot

Hypernyms:social group

Inherited Hypernyms:setsocial groupgroupabstractionentity

Direct Hyponyms:Four Hundredcampcar poolcliquecohortcompanyconfederacyconspiracycoteriehorsey sethorsy setingroupinner circlejet setpackparty

Full Hyponyms:

nnoun.cognitiona relatively permanent inclination to react in a particular way

Synset:bent

Examples:

the set of his mind was obvious

Derivationally Related Form:set

Hypernyms:disposition inclination tendency

Inherited Hypernyms:bentinclinationattitudecognitionpsychological featureabstractionentity

nnoun.actthe act of putting something in position

Examples:

he gave a final set to his hat

Derivationally Related Form:set

Hypernyms:emplacement locating location placement position positioning

Inherited Hypernyms:setplacementactivityacteventpsychological featureabstractionentity

nnoun.timea unit of play in tennis or squash

Examples:

they played two sets of tennis after dinner

Hypernyms:period of play play playing period

Inherited Hypernyms:setplaying periodmeasureabstractionentity

Part Meronyms:game

nnoun.processthe process of becoming hard or solid by cooling or drying or crystallization

Synset:curing hardening solidification solidifying

Examples:

the hardening of concrete
he tested the set of the glue

Derivationally Related Form:hardensolidifysetcure

Part Holonyms:plastination

Hypernyms:action activity natural action natural process

Inherited Hypernyms:hardeningnatural processprocessphysical entityentity

Direct Hyponyms:congealmentcongelation

Full Hyponyms:

nnoun.personevil Egyptian god with the head of a beast that has high square ears and a long snout; brother and murderer of Osiris

Synset:Set Seth

Instance Hypernyms:Egyptian deity

Inherited Hypernyms:setegyptian deitydeityspiritual beingbeliefcontentcognitionpsychological featureabstractionentity

nnoun.eventthe descent of a heavenly body below the horizon

Examples:

before the set of sun

Hypernyms:descent

Inherited Hypernyms:setdescentchange of locationmovementhappeningeventpsychological featureabstractionentity

nnoun.cognition(psychology) being temporarily ready to respond in a particular way

Topic:psychological sciencepsychology

Synset:readiness

Examples:

the subjects' set led them to solve problems the familiar way and to overlook the simpler solution
his instructions deliberately gave them the wrong set

Derivationally Related Form:set

Hypernyms:cognitive state state of mind

Inherited Hypernyms:setcognitive statepsychological stateconditionstateattributeabstractionentity

nnoun.artifactany electronic equipment that receives or transmits radio or tv signals

Examples:

the early sets ran on storage batteries

Part Holonyms:communication equipment communication system

Hypernyms:electronic equipment

Inherited Hypernyms:setelectronic equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity

Direct Hyponyms:receiverreceiving systemsendertransmitter

Full Hyponyms:

vverb.contactput into a certain place or abstract location

Synset:lay place pose position put

Examples:

Put your things here
Set the tray down
Set the dogs on the scent of the missing children
Place emphasis on a certain point

Derivationally Related Form:placementpositionersetplacepositionsetting

Hypernyms:displace move

Inherited Hypernyms:putmove

Direct Hyponyms:apposearrangebarrelbedbottlebucketbuttclapcockcoffincramdepositdisposedocketemplaceencloseensconcefixglyceroliseglycerolizegroundimbricateincloseinsertinstalinstallintersperseintroducejarjuxtaposeladlelaylay overleanloadmarshalmiddlemisplacenestleparallelizeparkperchpigeonholepilepillowplace downplace uprightplantpoisepositpositionpostposepreposeput backput downput inrack uprecessreclinereplacereposerepositionrestseatseedsetset downset upsettlesettle downshelveshipsignsiphonsitsit downsituatesnugglesowspacestandstand upstepstick instratifysuperimposesuperposeteetee upthrowthrusttrenchunderlayupend

Full Troponyms:addressafforestaimalphabetizeapposearrangebarrelbeadbedblowbottlebroadcastbucketburybuttcascadecatenatecatheterizechainchargecheckrowclapcockcodifycoffincollatecompartconcatenateconcordcordcorralcovercramcupdeclaredeploydevelopdibbledigestdisentangledisposedocketdrapedraw a bead ondressemplaceensconceevenfeedfoistgglassglycerolizegradategroundhang upholdhousecleanimbricateinjectinoculateinseminateinsertinsetinstallinterleaveinterlockintersperseinterstratifyjamjarjuxtaposeladlelayleanlevelline uploadmakemarshalmiddlemisplacenestleorderorganizeorientoverstuffpackpadpairparallelizeparkperchpigeonholepilepillowpitchplankplantplayplugpoisepoppositionpostpostposepreenpreposepuddlepyramidrack uprailrangerange inratravelre-afforestrearrangereburyrecessreclinerecodereducereforestregularizereinstallreplacereplantreposerepositionreseatreshipreshufflerestrestructureretrofitrickrootscatterseatsedimentseedserializesetset downsettleshelveshipsightsignsiphonsituateslipsowspacespatspawnspring-cleansquaresquare upstackstaggerstandstemstepstraightenstratifystringstring outstructurestuffsuperimposesuperposeswingsystematizetargetteaseteethrowtidytreetrenchturnunderlayupendwire

Sentence Frame:Somebody ---s something PP | They --- the bags on the table (apply to: pose, set, place, position, put, lay)

vverb.cognitionfix conclusively or authoritatively

Synset:determine

Examples:

set the rules

Derivationally Related Form:determinationset

Inherited Hypernyms:determine

Direct Hyponyms:assesschargedatefiliateformatidentifyinitialiseinitializeplacepricetaxvalue

Full Troponyms:chargechronologizecloistercontradistinguishcontrastdatedecoupledemarcatedisadvantagediscriminatedistinguishfiliatefloatformatghettoizehandicaphave the distinctionhive offidentifyindividualizeinitializeisolateknowlabellosemark upmaroonmisdateoverpriceovervaluepostdatepredateprejudicepricequarantineredlinerigsecludesegregateseveralizesexstratifysubtilizetaxunderquoteundervaluevalue

Sentence Frame:Somebody ---s something | Somebody ---s to somebody | Somebody ---s that CLAUSE | Something ---s something

vverb.communicationdecide upon or fix definitely

Synset:define determine fix limit specify

Examples:

fix the variables
specify the parameters

Derivationally Related Form:determinersetlimitdeterminant

Hypernyms:choose pick out select take

Inherited Hypernyms:specifychoosedecide

Direct Hyponyms:definenamequantifyreset

Full Troponyms:definenamequantifyredefinereset

Sentence Frame:Somebody ---s something

vverb.communicationestablish as the highest level or best performance

Synset:mark

Examples:

set a record

Derivationally Related Form:mark

Hypernyms:establish lay down make

Inherited Hypernyms:setlay downmake

Sentence Frame:Somebody ---s something | Something ---s something

vverb.changeput into a certain state; cause to be in a certain state

Examples:

set the house afire

Hypernyms:alter change modify

Inherited Hypernyms:setchange

Direct Hyponyms:keynotepitch

Full Troponyms:keynotepitch

Sentence Frame:Something ---s something Adjective/Noun | Somebody ---s something PP

vverb.contactfix in a border

Examples:

The goldsmith set the diamond

Derivationally Related Form:settingset

Hypernyms:arrange set up

Inherited Hypernyms:setarrangeputmove

Sentence Frame:Somebody ---s something

vverb.changemake ready or suitable or equip in advance for a particular purpose or for some use, event, etc

Synset:fix gear up prepare ready set up

Examples:

Get the children ready for school!
prepare for war
I was fixing to leave town after I paid the hotel bill

Derivationally Related Form:readyingpreparatorypreparationsetreadypreparative

Hypernyms:alter change modify

Inherited Hypernyms:fixchange

Direct Hyponyms:bracecramcropcultivatefixlay outmountpoisepreconditionprimeprovidesetset upsocialisesocializesummerisesummerizewinterisewinterizework

Full Troponyms:bracecramcultivatefixmountovercroppreconditionprimeprovideset upsocializesteelsummerizewinterize

vverb.changeset to a certain position or cause to operate correctly

Examples:

set clocks or instruments

Derivationally Related Form:setting

Hypernyms:adjust correct set

Inherited Hypernyms:setadjustchange

Direct Hyponyms:advanceresetset ahead

Full Troponyms:advancereset

Sentence Frame:Somebody ---s something

vverb.creationlocate

Synset:localise localize place

Examples:

The film is set in Africa

Derivationally Related Form:setplaceplacementlocalizationlocale

Hypernyms:present represent stage

Inherited Hypernyms:setstagere-createmake

Sentence Frame:Somebody ---s something PP

vverb.motiondisappear beyond the horizon

Topic:astronomyuranology

Synset:go down go under

Examples:

the sun sets early these days

Antonyms:rise

Hypernyms:come down descend fall go down

Inherited Hypernyms:setdescendtravel

Sentence Frame:Something ---s | The moon will soon --- (apply to: go down, go under, set)

vverb.creationadapt for performance in a different way

Topic:music

Synset:arrange

Examples:

set this poem to music

Derivationally Related Form:arranger

Hypernyms:compose write

Inherited Hypernyms:arrangecomposemake

Direct Hyponyms:prearrangeputtabletabularisetabularizetabulatetranspose

Full Troponyms:prearrangeputtabletranspose

Sentence Frame:Somebody ---s something | Did he --- his major works over a short period of time? (apply to: set, arrange)

vverb.contactput or set (seeds, seedlings, or plants) into the ground

Synset:plant

Examples:

Let's plant flowers in the garden

Derivationally Related Form:plantplantingplanterset

Hypernyms:lay place pose position put set

Inherited Hypernyms:plantputmove

Direct Hyponyms:afforestbedcheckrowdibbleforestpuddlereplantroottree

Full Troponyms:afforestbedcheckrowdibblepuddlere-afforestreforestreplantroottree

Sentence Frame:Somebody ---s something | They --- rye in the field (apply to: plant)

vverb.creationapply or start

Examples:

set fire to a building

Hypernyms:initiate originate start

Inherited Hypernyms:setoriginatemake

Sentence Frame:Somebody ---s something

vverb.changebecome gelatinous

Synset:congeal jell

Examples:

the liquid jelled after we added the enzyme

Derivationally Related Form:setcongelation

Hypernyms:solidify

Inherited Hypernyms:jellsolidifychange integritychange

Sentence Frame:Something ---s

vverb.creationset in type

Synset:typeset

Examples:

My book will be typeset nicely
set these words in italics

Derivationally Related Form:typesetter

Hypernyms:impress print

Inherited Hypernyms:typesetprintwritetracemarkchange

Sentence Frame:Somebody ---s something

vverb.contactput into a position that will restore a normal state

Examples:

set a broken bone

Derivationally Related Form:set

Hypernyms:lay place pose position put set

Inherited Hypernyms:setputmove

Sentence Frame:Somebody ---s something | Did he --- his foot? (apply to: set)

vverb.contactinsert (a nail or screw below the surface, as into a countersink)

Synset:countersink

Derivationally Related Form:countersink

Hypernyms:bury sink

Inherited Hypernyms:setburyimplantinsertattachconnect

Sentence Frame:Somebody ---s something

vverb.contactgive a fine, sharp edge to a knife or razor

Hypernyms:hone

Inherited Hypernyms:sethonesharpenchange

Sentence Frame:Somebody ---s something

vverb.competitionurge to attack someone

Synset:sic

Examples:

The owner sicked his dogs on the intruders
the shaman sics sorcerers on the evil spirits

Hypernyms:assail assault attack set on

Inherited Hypernyms:sicassail

Sentence Frame:Somebody ---s something on somebody

vverb.cognitionestimate

Synset:place put

Examples:

We put the time of arrival at 8 P.M.

Hypernyms:approximate estimate gauge guess judge

Inherited Hypernyms:placeestimatecalculatereasonthink

Sentence Frame:Somebody ---s something

vverb.changeequip with sails or masts

Synset:rig set up

Examples:

rig a ship

Derivationally Related Form:riggerriggingrig

Hypernyms:equip fit fit out outfit

Inherited Hypernyms:rigequipsupplygivetransfer

Sentence Frame:Somebody ---s something

vverb.changeget ready for a particular purpose or event

Synset:lay out set up

Examples:

set up an experiment
set the table
lay out the tools for the surgery

Derivationally Related Form:settingset

Hypernyms:fix gear up prepare ready set set up

Inherited Hypernyms:set upfixchange

Sentence Frame:Somebody ---s something

vverb.changealter or regulate so as to achieve accuracy or conform to a standard

Synset:adjust correct

Examples:

Adjust the clock, please
correct the alignment of the front wheels

Derivationally Related Form:adjustableadjustmentcorrectiveadjustiveadjuster

Hypernyms:alter change modify

Inherited Hypernyms:adjustchange

Direct Hyponyms:alignattunecalibratecitifycoordinatedecompressdepressurisedepressurizefine-tunefitfocalisefocalizefocusgraduateharmoniseharmonizejustifylineariselinearizematchmodulateordinateplumbpressurisepressurizeproportionreadjustreconcileregulateresetsetsharpensyncsynchronisesynchronizetempertimetrimtunetune upzerozero in

Full Troponyms:advancealignattunebalancecalibratecancelcarrycitifycompensatecomplementcounteractcoverdepressurizefine-tunefocusharmonizejustifykeylinearizematchmisalignmodulateoffsetoverridephaseplumbpressurizeproportionpuncturereadjustrefocusregulateresetscale downscale upservicesetsynchronizetempertimetrimtunetune inzero

Sentence Frame:Somebody ---s something | Something ---s something | Somebody ---s something PP

vverb.bodybear fruit

Synset:fructify

Examples:

the apple trees fructify

Derivationally Related Form:fruitfructification

Hypernyms:multiply procreate reproduce

Inherited Hypernyms:fructifyreproducemake

Sentence Frame:Something ---s

vverb.bodyarrange attractively

Synset:arrange coif coiffe coiffure do dress

Examples:

dress my hair for the wedding

Derivationally Related Form:arrangementcoiffure

Hypernyms:groom neaten

Inherited Hypernyms:dressgroomfancifybetterchange

Direct Hyponyms:bobwave

Full Troponyms:bobgauffermarcelpermwave

Sentence Frame:Somebody ---s something | They --- their hair (apply to: set, coiffure, coif, do, dress, arrange, coiffe)

adj satadj.all(usually followed by 'to' or 'for') on the point of or strongly disposed

Synset:fit primed

Examples:

in no fit state to continue
fit to drop
laughing fit to burst
she was fit to scream
primed for a fight
we are set to go at any time

Antonyms:unready

Derivationally Related Form:fitness

Inherited Hypernyms:fit

Similar to:ready

adj satadj.allfixed and unmoving

Synset:fixed rigid

Examples:

with eyes set in a fixed glassy stare
his bearded face already has a set hollow look - Connor Cruise O'Brien
a face rigid with pain

Antonyms:moving

Derivationally Related Form:fixednessrigidnessfixity

Inherited Hypernyms:fixed

Similar to:nonmoving unmoving

adj satadj.allsituated in a particular spot or position

Synset:located placed situated

Examples:

valuable centrally located urban land
strategically placed artillery
a house set on a hilltop
nicely situated on a quiet riverbank

Antonyms:unsettled

Inherited Hypernyms:located

Similar to:settled

adj satadj.allset down according to a plan

Synset:laid

Examples:

a carefully laid table with places set for four people
stones laid in a pattern

Antonyms:disarranged

Inherited Hypernyms:laid

Similar to:arranged ordered

adj satadj.allbeing below the horizon

Examples:

the moon is set

Antonyms:up

Inherited Hypernyms:set

Similar to:down

adj satadj.alldetermined or decided upon as by an authority

Synset:determined dictated

Examples:

date and place are already determined
the dictated terms of surrender
the time set for the launching

Antonyms:unsettled

Inherited Hypernyms:determined

Similar to:settled

adj satadj.allconverted to solid form (as concrete)

Synset:hardened

Antonyms:soft

Inherited Hypernyms:hardened

Similar to:hard

单词	set
释义	Set nnoun.groupa group of things of the same kind that belong together and are so used Examples: a set of books a set of golf clubs a set of teeth Hypernyms:accumulation aggregation assemblage collection Inherited Hypernyms:setcollectiongroupabstractionentity Direct Hyponyms:Cartesian productbracebracketchess setchoirconjugationconsortcorecore groupdentitionfieldintersectionjoinmanicure setnucleusoctetoctettepairportfolioproductquadruplequadrupletquartetquartettequintetquintettequintuplequintupletscoreseptetseptettesestetsextetsextettesingletonsuitesumsynsetteeththreescoretriadtriotripletripletunion Member Meronyms:volume Full Hyponyms: bedroom suitebit fieldbracketcadrechess setchoirconjugationcoredentitiondining-room suitedirect sumfieldincome bracketintersectionlivingroom suitemanicure setoctetpairportfolioprice bracketprimary dentitionquartetquintetscoresecondary dentitionseptetsextetsingletonsuitesynsetthreescoretrilogytriotriplicitytweedledum and tweedledeeunion nnoun.group(mathematics) an abstract collection of numbers or symbols Topic:mathmathematicsmaths Examples: the set of prime numbers is infinite Hypernyms:abstract entity abstraction Inherited Hypernyms:setabstractionentity Direct Hyponyms:Mandelbrot setdiagonaldomaindomain of a functionfieldgroupimageintersectionintervallocusmathematical groupmathematical spacenull setrangerange of a functionrootsolutionsubsettopological spaceuniversal set Full Hyponyms: abelian groupclosed intervaldiagonaldomaineuclidean spacefieldgrouphilbert spaceimageintersectionintervallocusmandelbrot setmanifoldmathematical spacemetric spacenull setnull spaceopen intervaloriginscalar fieldsolutionsub-intervalsubgroupsubsetsubspaceuniversal set nnoun.actseveral exercises intended to be done in series Synset:exercise set Examples: he did four sets of the incline bench press Hypernyms:exercise exercising physical exercise physical exertion workout Inherited Hypernyms:setexerciseeffortlaborworkactivityacteventpsychological featureabstractionentity nnoun.artifactrepresentation consisting of the scenery and other properties used to identify the location of a dramatic production Synset:stage set Examples: the sets were meticulously authentic Part Holonyms:mise en scene setting stage setting Hypernyms:representation Inherited Hypernyms:stage setrepresentationcreationartifactwholeobjectphysical entityentity Direct Hyponyms:scenescenery Part Meronyms:set decoration Full Hyponyms: backdropcoulisseflatmasking piecesceneryset piecetormenter nnoun.groupan unofficial association of people or groups Synset:band circle lot Examples: the smart set goes there they were an angry lot Hypernyms:social group Inherited Hypernyms:setsocial groupgroupabstractionentity Direct Hyponyms:Four Hundredcampcar poolcliquecohortcompanyconfederacyconspiracycoteriehorsey sethorsy setingroupinner circlejet setpackparty Full Hyponyms: bloomsbury groupbohemiacabalcar poolcliquecohortconspiracyfactionfatigue partyfour hundredgalerehard corehard righthorsy setjet setkitchen cabinetlanding partyleftloopmafiamilitary juntaold guardpartyparty to the actionpro-choice factionpro-life factionreligious rightrescue partyrightsearch partysplinter groupstretcher partywar party nnoun.cognitiona relatively permanent inclination to react in a particular way Synset:bent Examples: the set of his mind was obvious Derivationally Related Form:set Hypernyms:disposition inclination tendency Inherited Hypernyms:bentinclinationattitudecognitionpsychological featureabstractionentity nnoun.actthe act of putting something in position Examples: he gave a final set to his hat Derivationally Related Form:set Hypernyms:emplacement locating location placement position positioning Inherited Hypernyms:setplacementactivityacteventpsychological featureabstractionentity nnoun.timea unit of play in tennis or squash Examples: they played two sets of tennis after dinner Hypernyms:period of play play playing period Inherited Hypernyms:setplaying periodmeasureabstractionentity Part Meronyms:game nnoun.processthe process of becoming hard or solid by cooling or drying or crystallization Synset:curing hardening solidification solidifying Examples: the hardening of concrete he tested the set of the glue Derivationally Related Form:hardensolidifysetcure Part Holonyms:plastination Hypernyms:action activity natural action natural process Inherited Hypernyms:hardeningnatural processprocessphysical entityentity Direct Hyponyms:congealmentcongelation Full Hyponyms: congealment nnoun.personevil Egyptian god with the head of a beast that has high square ears and a long snout; brother and murderer of Osiris Synset:Set Seth Instance Hypernyms:Egyptian deity Inherited Hypernyms:setegyptian deitydeityspiritual beingbeliefcontentcognitionpsychological featureabstractionentity nnoun.eventthe descent of a heavenly body below the horizon Examples: before the set of sun Hypernyms:descent Inherited Hypernyms:setdescentchange of locationmovementhappeningeventpsychological featureabstractionentity nnoun.cognition(psychology) being temporarily ready to respond in a particular way Topic:psychological sciencepsychology Synset:readiness Examples: the subjects' set led them to solve problems the familiar way and to overlook the simpler solution his instructions deliberately gave them the wrong set Derivationally Related Form:set Hypernyms:cognitive state state of mind Inherited Hypernyms:setcognitive statepsychological stateconditionstateattributeabstractionentity nnoun.artifactany electronic equipment that receives or transmits radio or tv signals Examples: the early sets ran on storage batteries Part Holonyms:communication equipment communication system Hypernyms:electronic equipment Inherited Hypernyms:setelectronic equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity Direct Hyponyms:receiverreceiving systemsendertransmitter Full Hyponyms: clock radiocrystal setdirection findergoniometerheterodyne receiverjammerpush-button radioradio compassradio receiverradio transmitterreceiversatellite receiversatellite transmitterspark transmittertelevision receivertelevision transmittertransmitter vverb.contactput into a certain place or abstract location Synset:lay place pose position put Examples: Put your things here Set the tray down Set the dogs on the scent of the missing children Place emphasis on a certain point Derivationally Related Form:placementpositionersetplacepositionsetting Hypernyms:displace move Inherited Hypernyms:putmove Direct Hyponyms:apposearrangebarrelbedbottlebucketbuttclapcockcoffincramdepositdisposedocketemplaceencloseensconcefixglyceroliseglycerolizegroundimbricateincloseinsertinstalinstallintersperseintroducejarjuxtaposeladlelaylay overleanloadmarshalmiddlemisplacenestleparallelizeparkperchpigeonholepilepillowplace downplace uprightplantpoisepositpositionpostposepreposeput backput downput inrack uprecessreclinereplacereposerepositionrestseatseedsetset downset upsettlesettle downshelveshipsignsiphonsitsit downsituatesnugglesowspacestandstand upstepstick instratifysuperimposesuperposeteetee upthrowthrusttrenchunderlayupend Full Troponyms:addressafforestaimalphabetizeapposearrangebarrelbeadbedblowbottlebroadcastbucketburybuttcascadecatenatecatheterizechainchargecheckrowclapcockcodifycoffincollatecompartconcatenateconcordcordcorralcovercramcupdeclaredeploydevelopdibbledigestdisentangledisposedocketdrapedraw a bead ondressemplaceensconceevenfeedfoistgglassglycerolizegradategroundhang upholdhousecleanimbricateinjectinoculateinseminateinsertinsetinstallinterleaveinterlockintersperseinterstratifyjamjarjuxtaposeladlelayleanlevelline uploadmakemarshalmiddlemisplacenestleorderorganizeorientoverstuffpackpadpairparallelizeparkperchpigeonholepilepillowpitchplankplantplayplugpoisepoppositionpostpostposepreenpreposepuddlepyramidrack uprailrangerange inratravelre-afforestrearrangereburyrecessreclinerecodereducereforestregularizereinstallreplacereplantreposerepositionreseatreshipreshufflerestrestructureretrofitrickrootscatterseatsedimentseedserializesetset downsettleshelveshipsightsignsiphonsituateslipsowspacespatspawnspring-cleansquaresquare upstackstaggerstandstemstepstraightenstratifystringstring outstructurestuffsuperimposesuperposeswingsystematizetargetteaseteethrowtidytreetrenchturnunderlayupendwire Sentence Frame:Somebody ---s something PP \| They --- the bags on the table (apply to: pose, set, place, position, put, lay) vverb.cognitionfix conclusively or authoritatively Synset:determine Examples: set the rules Derivationally Related Form:determinationset Inherited Hypernyms:determine Direct Hyponyms:assesschargedatefiliateformatidentifyinitialiseinitializeplacepricetaxvalue Full Troponyms:chargechronologizecloistercontradistinguishcontrastdatedecoupledemarcatedisadvantagediscriminatedistinguishfiliatefloatformatghettoizehandicaphave the distinctionhive offidentifyindividualizeinitializeisolateknowlabellosemark upmaroonmisdateoverpriceovervaluepostdatepredateprejudicepricequarantineredlinerigsecludesegregateseveralizesexstratifysubtilizetaxunderquoteundervaluevalue Sentence Frame:Somebody ---s something \| Somebody ---s to somebody \| Somebody ---s that CLAUSE \| Something ---s something vverb.communicationdecide upon or fix definitely Synset:define determine fix limit specify Examples: fix the variables specify the parameters Derivationally Related Form:determinersetlimitdeterminant Hypernyms:choose pick out select take Inherited Hypernyms:specifychoosedecide Direct Hyponyms:definenamequantifyreset Full Troponyms:definenamequantifyredefinereset Sentence Frame:Somebody ---s something vverb.communicationestablish as the highest level or best performance Synset:mark Examples: set a record Derivationally Related Form:mark Hypernyms:establish lay down make Inherited Hypernyms:setlay downmake Sentence Frame:Somebody ---s something \| Something ---s something vverb.changeput into a certain state; cause to be in a certain state Examples: set the house afire Hypernyms:alter change modify Inherited Hypernyms:setchange Direct Hyponyms:keynotepitch Full Troponyms:keynotepitch Sentence Frame:Something ---s something Adjective/Noun \| Somebody ---s something PP vverb.contactfix in a border Examples: The goldsmith set the diamond Derivationally Related Form:settingset Hypernyms:arrange set up Inherited Hypernyms:setarrangeputmove Sentence Frame:Somebody ---s something vverb.changemake ready or suitable or equip in advance for a particular purpose or for some use, event, etc Synset:fix gear up prepare ready set up Examples: Get the children ready for school! prepare for war I was fixing to leave town after I paid the hotel bill Derivationally Related Form:readyingpreparatorypreparationsetreadypreparative Hypernyms:alter change modify Inherited Hypernyms:fixchange Direct Hyponyms:bracecramcropcultivatefixlay outmountpoisepreconditionprimeprovidesetset upsocialisesocializesummerisesummerizewinterisewinterizework Full Troponyms:bracecramcultivatefixmountovercroppreconditionprimeprovideset upsocializesteelsummerizewinterize Sentence Frame:Somebody ---s somebody PP \| Somebody ---s something PP \| Somebody ---s something \| Somebody ---s somebody \| Something ---s somebody \| Something ---s something \| Somebody ---s to INFINITIVE \| Somebody ---s (apply to: prepare, gear up) vverb.changeset to a certain position or cause to operate correctly Examples: set clocks or instruments Derivationally Related Form:setting Hypernyms:adjust correct set Inherited Hypernyms:setadjustchange Direct Hyponyms:advanceresetset ahead Full Troponyms:advancereset Sentence Frame:Somebody ---s something vverb.creationlocate Synset:localise localize place Examples: The film is set in Africa Derivationally Related Form:setplaceplacementlocalizationlocale Hypernyms:present represent stage Inherited Hypernyms:setstagere-createmake Sentence Frame:Somebody ---s something PP vverb.motiondisappear beyond the horizon Topic:astronomyuranology Synset:go down go under Examples: the sun sets early these days Antonyms:rise Hypernyms:come down descend fall go down Inherited Hypernyms:setdescendtravel Sentence Frame:Something ---s \| The moon will soon --- (apply to: go down, go under, set) vverb.creationadapt for performance in a different way Topic:music Synset:arrange Examples: set this poem to music Derivationally Related Form:arranger Hypernyms:compose write Inherited Hypernyms:arrangecomposemake Direct Hyponyms:prearrangeputtabletabularisetabularizetabulatetranspose Full Troponyms:prearrangeputtabletranspose Sentence Frame:Somebody ---s something \| Did he --- his major works over a short period of time? (apply to: set, arrange) vverb.contactput or set (seeds, seedlings, or plants) into the ground Synset:plant Examples: Let's plant flowers in the garden Derivationally Related Form:plantplantingplanterset Hypernyms:lay place pose position put set Inherited Hypernyms:plantputmove Direct Hyponyms:afforestbedcheckrowdibbleforestpuddlereplantroottree Full Troponyms:afforestbedcheckrowdibblepuddlere-afforestreforestreplantroottree Sentence Frame:Somebody ---s something \| They --- rye in the field (apply to: plant) vverb.creationapply or start Examples: set fire to a building Hypernyms:initiate originate start Inherited Hypernyms:setoriginatemake Sentence Frame:Somebody ---s something vverb.changebecome gelatinous Synset:congeal jell Examples: the liquid jelled after we added the enzyme Derivationally Related Form:setcongelation Hypernyms:solidify Inherited Hypernyms:jellsolidifychange integritychange Sentence Frame:Something ---s vverb.creationset in type Synset:typeset Examples: My book will be typeset nicely set these words in italics Derivationally Related Form:typesetter Hypernyms:impress print Inherited Hypernyms:typesetprintwritetracemarkchange Sentence Frame:Somebody ---s something vverb.contactput into a position that will restore a normal state Examples: set a broken bone Derivationally Related Form:set Hypernyms:lay place pose position put set Inherited Hypernyms:setputmove Sentence Frame:Somebody ---s something \| Did he --- his foot? (apply to: set) vverb.contactinsert (a nail or screw below the surface, as into a countersink) Synset:countersink Derivationally Related Form:countersink Hypernyms:bury sink Inherited Hypernyms:setburyimplantinsertattachconnect Sentence Frame:Somebody ---s something vverb.contactgive a fine, sharp edge to a knife or razor Hypernyms:hone Inherited Hypernyms:sethonesharpenchange Sentence Frame:Somebody ---s something vverb.competitionurge to attack someone Synset:sic Examples: The owner sicked his dogs on the intruders the shaman sics sorcerers on the evil spirits Hypernyms:assail assault attack set on Inherited Hypernyms:sicassail Sentence Frame:Somebody ---s something on somebody vverb.cognitionestimate Synset:place put Examples: We put the time of arrival at 8 P.M. Hypernyms:approximate estimate gauge guess judge Inherited Hypernyms:placeestimatecalculatereasonthink Sentence Frame:Somebody ---s something vverb.changeequip with sails or masts Synset:rig set up Examples: rig a ship Derivationally Related Form:riggerriggingrig Hypernyms:equip fit fit out outfit Inherited Hypernyms:rigequipsupplygivetransfer Sentence Frame:Somebody ---s something vverb.changeget ready for a particular purpose or event Synset:lay out set up Examples: set up an experiment set the table lay out the tools for the surgery Derivationally Related Form:settingset Hypernyms:fix gear up prepare ready set set up Inherited Hypernyms:set upfixchange Sentence Frame:Somebody ---s something vverb.changealter or regulate so as to achieve accuracy or conform to a standard Synset:adjust correct Examples: Adjust the clock, please correct the alignment of the front wheels Derivationally Related Form:adjustableadjustmentcorrectiveadjustiveadjuster Hypernyms:alter change modify Inherited Hypernyms:adjustchange Direct Hyponyms:alignattunecalibratecitifycoordinatedecompressdepressurisedepressurizefine-tunefitfocalisefocalizefocusgraduateharmoniseharmonizejustifylineariselinearizematchmodulateordinateplumbpressurisepressurizeproportionreadjustreconcileregulateresetsetsharpensyncsynchronisesynchronizetempertimetrimtunetune upzerozero in Full Troponyms:advancealignattunebalancecalibratecancelcarrycitifycompensatecomplementcounteractcoverdepressurizefine-tunefocusharmonizejustifykeylinearizematchmisalignmodulateoffsetoverridephaseplumbpressurizeproportionpuncturereadjustrefocusregulateresetscale downscale upservicesetsynchronizetempertimetrimtunetune inzero Sentence Frame:Somebody ---s something \| Something ---s something \| Somebody ---s something PP vverb.bodybear fruit Synset:fructify Examples: the apple trees fructify Derivationally Related Form:fruitfructification Hypernyms:multiply procreate reproduce Inherited Hypernyms:fructifyreproducemake Sentence Frame:Something ---s vverb.bodyarrange attractively Synset:arrange coif coiffe coiffure do dress Examples: dress my hair for the wedding Derivationally Related Form:arrangementcoiffure Hypernyms:groom neaten Inherited Hypernyms:dressgroomfancifybetterchange Direct Hyponyms:bobwave Full Troponyms:bobgauffermarcelpermwave Sentence Frame:Somebody ---s something \| They --- their hair (apply to: set, coiffure, coif, do, dress, arrange, coiffe) adj satadj.all(usually followed by 'to' or 'for') on the point of or strongly disposed Synset:fit primed Examples: in no fit state to continue fit to drop laughing fit to burst she was fit to scream primed for a fight we are set to go at any time Antonyms:unready Derivationally Related Form:fitness Inherited Hypernyms:fit Similar to:ready adj satadj.allfixed and unmoving Synset:fixed rigid Examples: with eyes set in a fixed glassy stare his bearded face already has a set hollow look - Connor Cruise O'Brien a face rigid with pain Antonyms:moving Derivationally Related Form:fixednessrigidnessfixity Inherited Hypernyms:fixed Similar to:nonmoving unmoving adj satadj.allsituated in a particular spot or position Synset:located placed situated Examples: valuable centrally located urban land strategically placed artillery a house set on a hilltop nicely situated on a quiet riverbank Antonyms:unsettled Inherited Hypernyms:located Similar to:settled adj satadj.allset down according to a plan Synset:laid Examples: a carefully laid table with places set for four people stones laid in a pattern Antonyms:disarranged Inherited Hypernyms:laid Similar to:arranged ordered adj satadj.allbeing below the horizon Examples: the moon is set Antonyms:up Inherited Hypernyms:set Similar to:down adj satadj.alldetermined or decided upon as by an authority Synset:determined dictated Examples: date and place are already determined the dictated terms of surrender the time set for the launching Antonyms:unsettled Inherited Hypernyms:determined Similar to:settled adj satadj.allconverted to solid form (as concrete) Synset:hardened Antonyms:soft Inherited Hypernyms:hardened Similar to:hard
随便看	youngish young lady young mammal young man youngness young person young's modulus youngster youngstown young turk young woman younker you said it youth youth crusade youth culture youthful youthfully youthfulness youth gang youth hostel youth movement youth-on-age youth subculture yowl