请输入您要查询的英文单词:

 

单词 set
释义
Set
nnoun.groupa group of things of the same kind that belong together and are so used
Examples:
  • a set of books
  • a set of golf clubs
  • a set of teeth
Hypernyms:accumulation aggregation assemblage collection
Inherited Hypernyms:setcollectiongroupabstractionentity
Direct Hyponyms:Cartesian productbracebracketchess setchoirconjugationconsortcorecore groupdentitionfieldintersectionjoinmanicure setnucleusoctetoctettepairportfolioproductquadruplequadrupletquartetquartettequintetquintettequintuplequintupletscoreseptetseptettesestetsextetsextettesingletonsuitesumsynsetteeththreescoretriadtriotripletripletunion
Member Meronyms:volume
Full Hyponyms:
bedroom suitebit fieldbracketcadrechess setchoirconjugationcoredentitiondining-room suitedirect sumfieldincome bracketintersectionlivingroom suitemanicure setoctetpairportfolioprice bracketprimary dentitionquartetquintetscoresecondary dentitionseptetsextetsingletonsuitesynsetthreescoretrilogytriotriplicitytweedledum and tweedledeeunion
nnoun.group(mathematics) an abstract collection of numbers or symbols
Topic:mathmathematicsmaths
Examples:
  • the set of prime numbers is infinite
Hypernyms:abstract entity abstraction
Inherited Hypernyms:setabstractionentity
Direct Hyponyms:Mandelbrot setdiagonaldomaindomain of a functionfieldgroupimageintersectionintervallocusmathematical groupmathematical spacenull setrangerange of a functionrootsolutionsubsettopological spaceuniversal set
Full Hyponyms:
abelian groupclosed intervaldiagonaldomaineuclidean spacefieldgrouphilbert spaceimageintersectionintervallocusmandelbrot setmanifoldmathematical spacemetric spacenull setnull spaceopen intervaloriginscalar fieldsolutionsub-intervalsubgroupsubsetsubspaceuniversal set
nnoun.actseveral exercises intended to be done in series
Synset:exercise set
Examples:
  • he did four sets of the incline bench press
Hypernyms:exercise exercising physical exercise physical exertion workout
Inherited Hypernyms:setexerciseeffortlaborworkactivityacteventpsychological featureabstractionentity
nnoun.artifactrepresentation consisting of the scenery and other properties used to identify the location of a dramatic production
Synset:stage set
Examples:
  • the sets were meticulously authentic
Part Holonyms:mise en scene setting stage setting
Hypernyms:representation
Inherited Hypernyms:stage setrepresentationcreationartifactwholeobjectphysical entityentity
Direct Hyponyms:scenescenery
Part Meronyms:set decoration
Full Hyponyms:
backdropcoulisseflatmasking piecesceneryset piecetormenter
nnoun.groupan unofficial association of people or groups
Synset:band circle lot
Examples:
  • the smart set goes there
  • they were an angry lot
Hypernyms:social group
Inherited Hypernyms:setsocial groupgroupabstractionentity
Direct Hyponyms:Four Hundredcampcar poolcliquecohortcompanyconfederacyconspiracycoteriehorsey sethorsy setingroupinner circlejet setpackparty
Full Hyponyms:
bloomsbury groupbohemiacabalcar poolcliquecohortconspiracyfactionfatigue partyfour hundredgalerehard corehard righthorsy setjet setkitchen cabinetlanding partyleftloopmafiamilitary juntaold guardpartyparty to the actionpro-choice factionpro-life factionreligious rightrescue partyrightsearch partysplinter groupstretcher partywar party
nnoun.cognitiona relatively permanent inclination to react in a particular way
Synset:bent
Examples:
  • the set of his mind was obvious
Derivationally Related Form:set
Hypernyms:disposition inclination tendency
Inherited Hypernyms:bentinclinationattitudecognitionpsychological featureabstractionentity
nnoun.actthe act of putting something in position
Examples:
  • he gave a final set to his hat
Derivationally Related Form:set
Hypernyms:emplacement locating location placement position positioning
Inherited Hypernyms:setplacementactivityacteventpsychological featureabstractionentity
nnoun.timea unit of play in tennis or squash
Examples:
  • they played two sets of tennis after dinner
Hypernyms:period of play play playing period
Inherited Hypernyms:setplaying periodmeasureabstractionentity
Part Meronyms:game
nnoun.processthe process of becoming hard or solid by cooling or drying or crystallization
Synset:curing hardening solidification solidifying
Examples:
  • the hardening of concrete
  • he tested the set of the glue
Derivationally Related Form:hardensolidifysetcure
Part Holonyms:plastination
Hypernyms:action activity natural action natural process
Inherited Hypernyms:hardeningnatural processprocessphysical entityentity
Direct Hyponyms:congealmentcongelation
Full Hyponyms:
congealment
nnoun.personevil Egyptian god with the head of a beast that has high square ears and a long snout; brother and murderer of Osiris
Synset:Set Seth
Instance Hypernyms:Egyptian deity
Inherited Hypernyms:setegyptian deitydeityspiritual beingbeliefcontentcognitionpsychological featureabstractionentity
nnoun.eventthe descent of a heavenly body below the horizon
Examples:
  • before the set of sun
Hypernyms:descent
Inherited Hypernyms:setdescentchange of locationmovementhappeningeventpsychological featureabstractionentity
nnoun.cognition(psychology) being temporarily ready to respond in a particular way
Topic:psychological sciencepsychology
Synset:readiness
Examples:
  • the subjects' set led them to solve problems the familiar way and to overlook the simpler solution
  • his instructions deliberately gave them the wrong set
Derivationally Related Form:set
Hypernyms:cognitive state state of mind
Inherited Hypernyms:setcognitive statepsychological stateconditionstateattributeabstractionentity
nnoun.artifactany electronic equipment that receives or transmits radio or tv signals
Examples:
  • the early sets ran on storage batteries
Part Holonyms:communication equipment communication system
Hypernyms:electronic equipment
Inherited Hypernyms:setelectronic equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity
Direct Hyponyms:receiverreceiving systemsendertransmitter
Full Hyponyms:
clock radiocrystal setdirection findergoniometerheterodyne receiverjammerpush-button radioradio compassradio receiverradio transmitterreceiversatellite receiversatellite transmitterspark transmittertelevision receivertelevision transmittertransmitter
vverb.contactput into a certain place or abstract location
Synset:lay place pose position put
Examples:
  • Put your things here
  • Set the tray down
  • Set the dogs on the scent of the missing children
  • Place emphasis on a certain point
Derivationally Related Form:placementpositionersetplacepositionsetting
Hypernyms:displace move
Inherited Hypernyms:putmove
Direct Hyponyms:apposearrangebarrelbedbottlebucketbuttclapcockcoffincramdepositdisposedocketemplaceencloseensconcefixglyceroliseglycerolizegroundimbricateincloseinsertinstalinstallintersperseintroducejarjuxtaposeladlelaylay overleanloadmarshalmiddlemisplacenestleparallelizeparkperchpigeonholepilepillowplace downplace uprightplantpoisepositpositionpostposepreposeput backput downput inrack uprecessreclinereplacereposerepositionrestseatseedsetset downset upsettlesettle downshelveshipsignsiphonsitsit downsituatesnugglesowspacestandstand upstepstick instratifysuperimposesuperposeteetee upthrowthrusttrenchunderlayupend
Full Troponyms:addressafforestaimalphabetizeapposearrangebarrelbeadbedblowbottlebroadcastbucketburybuttcascadecatenatecatheterizechainchargecheckrowclapcockcodifycoffincollatecompartconcatenateconcordcordcorralcovercramcupdeclaredeploydevelopdibbledigestdisentangledisposedocketdrapedraw a bead ondressemplaceensconceevenfeedfoistgglassglycerolizegradategroundhang upholdhousecleanimbricateinjectinoculateinseminateinsertinsetinstallinterleaveinterlockintersperseinterstratifyjamjarjuxtaposeladlelayleanlevelline uploadmakemarshalmiddlemisplacenestleorderorganizeorientoverstuffpackpadpairparallelizeparkperchpigeonholepilepillowpitchplankplantplayplugpoisepoppositionpostpostposepreenpreposepuddlepyramidrack uprailrangerange inratravelre-afforestrearrangereburyrecessreclinerecodereducereforestregularizereinstallreplacereplantreposerepositionreseatreshipreshufflerestrestructureretrofitrickrootscatterseatsedimentseedserializesetset downsettleshelveshipsightsignsiphonsituateslipsowspacespatspawnspring-cleansquaresquare upstackstaggerstandstemstepstraightenstratifystringstring outstructurestuffsuperimposesuperposeswingsystematizetargetteaseteethrowtidytreetrenchturnunderlayupendwire
Sentence Frame:Somebody ---s something PP | They --- the bags on the table (apply to: pose, set, place, position, put, lay)
vverb.cognitionfix conclusively or authoritatively
Synset:determine
Examples:
  • set the rules
Derivationally Related Form:determinationset
Inherited Hypernyms:determine
Direct Hyponyms:assesschargedatefiliateformatidentifyinitialiseinitializeplacepricetaxvalue
Full Troponyms:chargechronologizecloistercontradistinguishcontrastdatedecoupledemarcatedisadvantagediscriminatedistinguishfiliatefloatformatghettoizehandicaphave the distinctionhive offidentifyindividualizeinitializeisolateknowlabellosemark upmaroonmisdateoverpriceovervaluepostdatepredateprejudicepricequarantineredlinerigsecludesegregateseveralizesexstratifysubtilizetaxunderquoteundervaluevalue
Sentence Frame:Somebody ---s something | Somebody ---s to somebody | Somebody ---s that CLAUSE | Something ---s something
vverb.communicationdecide upon or fix definitely
Synset:define determine fix limit specify
Examples:
  • fix the variables
  • specify the parameters
Derivationally Related Form:determinersetlimitdeterminant
Hypernyms:choose pick out select take
Inherited Hypernyms:specifychoosedecide
Direct Hyponyms:definenamequantifyreset
Full Troponyms:definenamequantifyredefinereset
Sentence Frame:Somebody ---s something
vverb.communicationestablish as the highest level or best performance
Synset:mark
Examples:
  • set a record
Derivationally Related Form:mark
Hypernyms:establish lay down make
Inherited Hypernyms:setlay downmake
Sentence Frame:Somebody ---s something | Something ---s something
vverb.changeput into a certain state; cause to be in a certain state
Examples:
  • set the house afire
Hypernyms:alter change modify
Inherited Hypernyms:setchange
Direct Hyponyms:keynotepitch
Full Troponyms:keynotepitch
Sentence Frame:Something ---s something Adjective/Noun | Somebody ---s something PP
vverb.contactfix in a border
Examples:
  • The goldsmith set the diamond
Derivationally Related Form:settingset
Hypernyms:arrange set up
Inherited Hypernyms:setarrangeputmove
Sentence Frame:Somebody ---s something
vverb.changemake ready or suitable or equip in advance for a particular purpose or for some use, event, etc
Synset:fix gear up prepare ready set up
Examples:
  • Get the children ready for school!
  • prepare for war
  • I was fixing to leave town after I paid the hotel bill
Derivationally Related Form:readyingpreparatorypreparationsetreadypreparative
Hypernyms:alter change modify
Inherited Hypernyms:fixchange
Direct Hyponyms:bracecramcropcultivatefixlay outmountpoisepreconditionprimeprovidesetset upsocialisesocializesummerisesummerizewinterisewinterizework
Full Troponyms:bracecramcultivatefixmountovercroppreconditionprimeprovideset upsocializesteelsummerizewinterize
Sentence Frame:Somebody ---s somebody PP | Somebody ---s something PP | Somebody ---s something | Somebody ---s somebody | Something ---s somebody | Something ---s something | Somebody ---s to INFINITIVE | Somebody ---s (apply to: prepare, gear up)
vverb.changeset to a certain position or cause to operate correctly
Examples:
  • set clocks or instruments
Derivationally Related Form:setting
Hypernyms:adjust correct set
Inherited Hypernyms:setadjustchange
Direct Hyponyms:advanceresetset ahead
Full Troponyms:advancereset
Sentence Frame:Somebody ---s something
vverb.creationlocate
Synset:localise localize place
Examples:
  • The film is set in Africa
Derivationally Related Form:setplaceplacementlocalizationlocale
Hypernyms:present represent stage
Inherited Hypernyms:setstagere-createmake
Sentence Frame:Somebody ---s something PP
vverb.motiondisappear beyond the horizon
Topic:astronomyuranology
Synset:go down go under
Examples:
  • the sun sets early these days
Antonyms:rise
Hypernyms:come down descend fall go down
Inherited Hypernyms:setdescendtravel
Sentence Frame:Something ---s | The moon will soon --- (apply to: go down, go under, set)
vverb.creationadapt for performance in a different way
Topic:music
Synset:arrange
Examples:
  • set this poem to music
Derivationally Related Form:arranger
Hypernyms:compose write
Inherited Hypernyms:arrangecomposemake
Direct Hyponyms:prearrangeputtabletabularisetabularizetabulatetranspose
Full Troponyms:prearrangeputtabletranspose
Sentence Frame:Somebody ---s something | Did he --- his major works over a short period of time? (apply to: set, arrange)
vverb.contactput or set (seeds, seedlings, or plants) into the ground
Synset:plant
Examples:
  • Let's plant flowers in the garden
Derivationally Related Form:plantplantingplanterset
Hypernyms:lay place pose position put set
Inherited Hypernyms:plantputmove
Direct Hyponyms:afforestbedcheckrowdibbleforestpuddlereplantroottree
Full Troponyms:afforestbedcheckrowdibblepuddlere-afforestreforestreplantroottree
Sentence Frame:Somebody ---s something | They --- rye in the field (apply to: plant)
vverb.creationapply or start
Examples:
  • set fire to a building
Hypernyms:initiate originate start
Inherited Hypernyms:setoriginatemake
Sentence Frame:Somebody ---s something
vverb.changebecome gelatinous
Synset:congeal jell
Examples:
  • the liquid jelled after we added the enzyme
Derivationally Related Form:setcongelation
Hypernyms:solidify
Inherited Hypernyms:jellsolidifychange integritychange
Sentence Frame:Something ---s
vverb.creationset in type
Synset:typeset
Examples:
  • My book will be typeset nicely
  • set these words in italics
Derivationally Related Form:typesetter
Hypernyms:impress print
Inherited Hypernyms:typesetprintwritetracemarkchange
Sentence Frame:Somebody ---s something
vverb.contactput into a position that will restore a normal state
Examples:
  • set a broken bone
Derivationally Related Form:set
Hypernyms:lay place pose position put set
Inherited Hypernyms:setputmove
Sentence Frame:Somebody ---s something | Did he --- his foot? (apply to: set)
vverb.contactinsert (a nail or screw below the surface, as into a countersink)
Synset:countersink
Derivationally Related Form:countersink
Hypernyms:bury sink
Inherited Hypernyms:setburyimplantinsertattachconnect
Sentence Frame:Somebody ---s something
vverb.contactgive a fine, sharp edge to a knife or razor
Hypernyms:hone
Inherited Hypernyms:sethonesharpenchange
Sentence Frame:Somebody ---s something
vverb.competitionurge to attack someone
Synset:sic
Examples:
  • The owner sicked his dogs on the intruders
  • the shaman sics sorcerers on the evil spirits
Hypernyms:assail assault attack set on
Inherited Hypernyms:sicassail
Sentence Frame:Somebody ---s something on somebody
vverb.cognitionestimate
Synset:place put
Examples:
  • We put the time of arrival at 8 P.M.
Hypernyms:approximate estimate gauge guess judge
Inherited Hypernyms:placeestimatecalculatereasonthink
Sentence Frame:Somebody ---s something
vverb.changeequip with sails or masts
Synset:rig set up
Examples:
  • rig a ship
Derivationally Related Form:riggerriggingrig
Hypernyms:equip fit fit out outfit
Inherited Hypernyms:rigequipsupplygivetransfer
Sentence Frame:Somebody ---s something
vverb.changeget ready for a particular purpose or event
Synset:lay out set up
Examples:
  • set up an experiment
  • set the table
  • lay out the tools for the surgery
Derivationally Related Form:settingset
Hypernyms:fix gear up prepare ready set set up
Inherited Hypernyms:set upfixchange
Sentence Frame:Somebody ---s something
vverb.changealter or regulate so as to achieve accuracy or conform to a standard
Synset:adjust correct
Examples:
  • Adjust the clock, please
  • correct the alignment of the front wheels
Derivationally Related Form:adjustableadjustmentcorrectiveadjustiveadjuster
Hypernyms:alter change modify
Inherited Hypernyms:adjustchange
Direct Hyponyms:alignattunecalibratecitifycoordinatedecompressdepressurisedepressurizefine-tunefitfocalisefocalizefocusgraduateharmoniseharmonizejustifylineariselinearizematchmodulateordinateplumbpressurisepressurizeproportionreadjustreconcileregulateresetsetsharpensyncsynchronisesynchronizetempertimetrimtunetune upzerozero in
Full Troponyms:advancealignattunebalancecalibratecancelcarrycitifycompensatecomplementcounteractcoverdepressurizefine-tunefocusharmonizejustifykeylinearizematchmisalignmodulateoffsetoverridephaseplumbpressurizeproportionpuncturereadjustrefocusregulateresetscale downscale upservicesetsynchronizetempertimetrimtunetune inzero
Sentence Frame:Somebody ---s something | Something ---s something | Somebody ---s something PP
vverb.bodybear fruit
Synset:fructify
Examples:
  • the apple trees fructify
Derivationally Related Form:fruitfructification
Hypernyms:multiply procreate reproduce
Inherited Hypernyms:fructifyreproducemake
Sentence Frame:Something ---s
vverb.bodyarrange attractively
Synset:arrange coif coiffe coiffure do dress
Examples:
  • dress my hair for the wedding
Derivationally Related Form:arrangementcoiffure
Hypernyms:groom neaten
Inherited Hypernyms:dressgroomfancifybetterchange
Direct Hyponyms:bobwave
Full Troponyms:bobgauffermarcelpermwave
Sentence Frame:Somebody ---s something | They --- their hair (apply to: set, coiffure, coif, do, dress, arrange, coiffe)
adj satadj.all(usually followed by 'to' or 'for') on the point of or strongly disposed
Synset:fit primed
Examples:
  • in no fit state to continue
  • fit to drop
  • laughing fit to burst
  • she was fit to scream
  • primed for a fight
  • we are set to go at any time
Antonyms:unready
Derivationally Related Form:fitness
Inherited Hypernyms:fit
Similar to:ready
adj satadj.allfixed and unmoving
Synset:fixed rigid
Examples:
  • with eyes set in a fixed glassy stare
  • his bearded face already has a set hollow look - Connor Cruise O'Brien
  • a face rigid with pain
Antonyms:moving
Derivationally Related Form:fixednessrigidnessfixity
Inherited Hypernyms:fixed
Similar to:nonmoving unmoving
adj satadj.allsituated in a particular spot or position
Synset:located placed situated
Examples:
  • valuable centrally located urban land
  • strategically placed artillery
  • a house set on a hilltop
  • nicely situated on a quiet riverbank
Antonyms:unsettled
Inherited Hypernyms:located
Similar to:settled
adj satadj.allset down according to a plan
Synset:laid
Examples:
  • a carefully laid table with places set for four people
  • stones laid in a pattern
Antonyms:disarranged
Inherited Hypernyms:laid
Similar to:arranged ordered
adj satadj.allbeing below the horizon
Examples:
  • the moon is set
Antonyms:up
Inherited Hypernyms:set
Similar to:down
adj satadj.alldetermined or decided upon as by an authority
Synset:determined dictated
Examples:
  • date and place are already determined
  • the dictated terms of surrender
  • the time set for the launching
Antonyms:unsettled
Inherited Hypernyms:determined
Similar to:settled
adj satadj.allconverted to solid form (as concrete)
Synset:hardened
Antonyms:soft
Inherited Hypernyms:hardened
Similar to:hard
随便看

 

英语词典包含147479条英英释义在线翻译词条,基本涵盖了全部常用单词的英英翻译及用法,是英语学习的有利工具。

 

Copyright © 2004-2022 Newdu.com All Rights Reserved
更新时间:2026/5/23 4:35:24