英语词汇“set”的英英意思、用法、释义、翻译、读音、例句、短语、词组-英语词典

Set

nnoun.groupa group of things of the same kind that belong together and are so used

Examples:

a set of books
a set of golf clubs
a set of teeth

Hypernyms:accumulation aggregation assemblage collection

Inherited Hypernyms:setcollectiongroupabstractionentity

Direct Hyponyms:Cartesian productbracebracketchess setchoirconjugationconsortcorecore groupdentitionfieldintersectionjoinmanicure setnucleusoctetoctettepairportfolioproductquadruplequadrupletquartetquartettequintetquintettequintuplequintupletscoreseptetseptettesestetsextetsextettesingletonsuitesumsynsetteeththreescoretriadtriotripletripletunion

Member Meronyms:volume

Full Hyponyms:

nnoun.group(mathematics) an abstract collection of numbers or symbols

Topic:mathmathematicsmaths

Examples:

the set of prime numbers is infinite

Hypernyms:abstract entity abstraction

Inherited Hypernyms:setabstractionentity

Direct Hyponyms:Mandelbrot setdiagonaldomaindomain of a functionfieldgroupimageintersectionintervallocusmathematical groupmathematical spacenull setrangerange of a functionrootsolutionsubsettopological spaceuniversal set

Full Hyponyms:

nnoun.actseveral exercises intended to be done in series

Synset:exercise set

Examples:

he did four sets of the incline bench press

Hypernyms:exercise exercising physical exercise physical exertion workout

Inherited Hypernyms:setexerciseeffortlaborworkactivityacteventpsychological featureabstractionentity

nnoun.artifactrepresentation consisting of the scenery and other properties used to identify the location of a dramatic production

Synset:stage set

Examples:

the sets were meticulously authentic

Part Holonyms:mise en scene setting stage setting

Hypernyms:representation

Inherited Hypernyms:stage setrepresentationcreationartifactwholeobjectphysical entityentity

Direct Hyponyms:scenescenery

Part Meronyms:set decoration

Full Hyponyms:

nnoun.groupan unofficial association of people or groups

Synset:band circle lot

Examples:

the smart set goes there
they were an angry lot

Hypernyms:social group

Inherited Hypernyms:setsocial groupgroupabstractionentity

Direct Hyponyms:Four Hundredcampcar poolcliquecohortcompanyconfederacyconspiracycoteriehorsey sethorsy setingroupinner circlejet setpackparty

Full Hyponyms:

nnoun.cognitiona relatively permanent inclination to react in a particular way

Synset:bent

Examples:

the set of his mind was obvious

Derivationally Related Form:set

Hypernyms:disposition inclination tendency

Inherited Hypernyms:bentinclinationattitudecognitionpsychological featureabstractionentity

nnoun.actthe act of putting something in position

Examples:

he gave a final set to his hat

Derivationally Related Form:set

Hypernyms:emplacement locating location placement position positioning

Inherited Hypernyms:setplacementactivityacteventpsychological featureabstractionentity

nnoun.timea unit of play in tennis or squash

Examples:

they played two sets of tennis after dinner

Hypernyms:period of play play playing period

Inherited Hypernyms:setplaying periodmeasureabstractionentity

Part Meronyms:game

nnoun.processthe process of becoming hard or solid by cooling or drying or crystallization

Synset:curing hardening solidification solidifying

Examples:

the hardening of concrete
he tested the set of the glue

Derivationally Related Form:hardensolidifysetcure

Part Holonyms:plastination

Hypernyms:action activity natural action natural process

Inherited Hypernyms:hardeningnatural processprocessphysical entityentity

Direct Hyponyms:congealmentcongelation

Full Hyponyms:

nnoun.personevil Egyptian god with the head of a beast that has high square ears and a long snout; brother and murderer of Osiris

Synset:Set Seth

Instance Hypernyms:Egyptian deity

Inherited Hypernyms:setegyptian deitydeityspiritual beingbeliefcontentcognitionpsychological featureabstractionentity

nnoun.eventthe descent of a heavenly body below the horizon

Examples:

before the set of sun

Hypernyms:descent

Inherited Hypernyms:setdescentchange of locationmovementhappeningeventpsychological featureabstractionentity

nnoun.cognition(psychology) being temporarily ready to respond in a particular way

Topic:psychological sciencepsychology

Synset:readiness

Examples:

the subjects' set led them to solve problems the familiar way and to overlook the simpler solution
his instructions deliberately gave them the wrong set

Derivationally Related Form:set

Hypernyms:cognitive state state of mind

Inherited Hypernyms:setcognitive statepsychological stateconditionstateattributeabstractionentity

nnoun.artifactany electronic equipment that receives or transmits radio or tv signals

Examples:

the early sets ran on storage batteries

Part Holonyms:communication equipment communication system

Hypernyms:electronic equipment

Inherited Hypernyms:setelectronic equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity

Direct Hyponyms:receiverreceiving systemsendertransmitter

Full Hyponyms:

vverb.contactput into a certain place or abstract location

Synset:lay place pose position put

Examples:

Put your things here
Set the tray down
Set the dogs on the scent of the missing children
Place emphasis on a certain point

Derivationally Related Form:placementpositionersetplacepositionsetting

Hypernyms:displace move

Inherited Hypernyms:putmove

Direct Hyponyms:apposearrangebarrelbedbottlebucketbuttclapcockcoffincramdepositdisposedocketemplaceencloseensconcefixglyceroliseglycerolizegroundimbricateincloseinsertinstalinstallintersperseintroducejarjuxtaposeladlelaylay overleanloadmarshalmiddlemisplacenestleparallelizeparkperchpigeonholepilepillowplace downplace uprightplantpoisepositpositionpostposepreposeput backput downput inrack uprecessreclinereplacereposerepositionrestseatseedsetset downset upsettlesettle downshelveshipsignsiphonsitsit downsituatesnugglesowspacestandstand upstepstick instratifysuperimposesuperposeteetee upthrowthrusttrenchunderlayupend

Full Troponyms:addressafforestaimalphabetizeapposearrangebarrelbeadbedblowbottlebroadcastbucketburybuttcascadecatenatecatheterizechainchargecheckrowclapcockcodifycoffincollatecompartconcatenateconcordcordcorralcovercramcupdeclaredeploydevelopdibbledigestdisentangledisposedocketdrapedraw a bead ondressemplaceensconceevenfeedfoistgglassglycerolizegradategroundhang upholdhousecleanimbricateinjectinoculateinseminateinsertinsetinstallinterleaveinterlockintersperseinterstratifyjamjarjuxtaposeladlelayleanlevelline uploadmakemarshalmiddlemisplacenestleorderorganizeorientoverstuffpackpadpairparallelizeparkperchpigeonholepilepillowpitchplankplantplayplugpoisepoppositionpostpostposepreenpreposepuddlepyramidrack uprailrangerange inratravelre-afforestrearrangereburyrecessreclinerecodereducereforestregularizereinstallreplacereplantreposerepositionreseatreshipreshufflerestrestructureretrofitrickrootscatterseatsedimentseedserializesetset downsettleshelveshipsightsignsiphonsituateslipsowspacespatspawnspring-cleansquaresquare upstackstaggerstandstemstepstraightenstratifystringstring outstructurestuffsuperimposesuperposeswingsystematizetargetteaseteethrowtidytreetrenchturnunderlayupendwire

Sentence Frame:Somebody ---s something PP | They --- the bags on the table (apply to: pose, set, place, position, put, lay)

vverb.cognitionfix conclusively or authoritatively

Synset:determine

Examples:

set the rules

Derivationally Related Form:determinationset

Inherited Hypernyms:determine

Direct Hyponyms:assesschargedatefiliateformatidentifyinitialiseinitializeplacepricetaxvalue

Full Troponyms:chargechronologizecloistercontradistinguishcontrastdatedecoupledemarcatedisadvantagediscriminatedistinguishfiliatefloatformatghettoizehandicaphave the distinctionhive offidentifyindividualizeinitializeisolateknowlabellosemark upmaroonmisdateoverpriceovervaluepostdatepredateprejudicepricequarantineredlinerigsecludesegregateseveralizesexstratifysubtilizetaxunderquoteundervaluevalue

Sentence Frame:Somebody ---s something | Somebody ---s to somebody | Somebody ---s that CLAUSE | Something ---s something

vverb.communicationdecide upon or fix definitely

Synset:define determine fix limit specify

Examples:

fix the variables
specify the parameters

Derivationally Related Form:determinersetlimitdeterminant

Hypernyms:choose pick out select take

Inherited Hypernyms:specifychoosedecide

Direct Hyponyms:definenamequantifyreset

Full Troponyms:definenamequantifyredefinereset

Sentence Frame:Somebody ---s something

vverb.communicationestablish as the highest level or best performance

Synset:mark

Examples:

set a record

Derivationally Related Form:mark

Hypernyms:establish lay down make

Inherited Hypernyms:setlay downmake

Sentence Frame:Somebody ---s something | Something ---s something

vverb.changeput into a certain state; cause to be in a certain state

Examples:

set the house afire

Hypernyms:alter change modify

Inherited Hypernyms:setchange

Direct Hyponyms:keynotepitch

Full Troponyms:keynotepitch

Sentence Frame:Something ---s something Adjective/Noun | Somebody ---s something PP

vverb.contactfix in a border

Examples:

The goldsmith set the diamond

Derivationally Related Form:settingset

Hypernyms:arrange set up

Inherited Hypernyms:setarrangeputmove

Sentence Frame:Somebody ---s something

vverb.changemake ready or suitable or equip in advance for a particular purpose or for some use, event, etc

Synset:fix gear up prepare ready set up

Examples:

Get the children ready for school!
prepare for war
I was fixing to leave town after I paid the hotel bill

Derivationally Related Form:readyingpreparatorypreparationsetreadypreparative

Hypernyms:alter change modify

Inherited Hypernyms:fixchange

Direct Hyponyms:bracecramcropcultivatefixlay outmountpoisepreconditionprimeprovidesetset upsocialisesocializesummerisesummerizewinterisewinterizework

Full Troponyms:bracecramcultivatefixmountovercroppreconditionprimeprovideset upsocializesteelsummerizewinterize

vverb.changeset to a certain position or cause to operate correctly

Examples:

set clocks or instruments

Derivationally Related Form:setting

Hypernyms:adjust correct set

Inherited Hypernyms:setadjustchange

Direct Hyponyms:advanceresetset ahead

Full Troponyms:advancereset

Sentence Frame:Somebody ---s something

vverb.creationlocate

Synset:localise localize place

Examples:

The film is set in Africa

Derivationally Related Form:setplaceplacementlocalizationlocale

Hypernyms:present represent stage

Inherited Hypernyms:setstagere-createmake

Sentence Frame:Somebody ---s something PP

vverb.motiondisappear beyond the horizon

Topic:astronomyuranology

Synset:go down go under

Examples:

the sun sets early these days

Antonyms:rise

Hypernyms:come down descend fall go down

Inherited Hypernyms:setdescendtravel

Sentence Frame:Something ---s | The moon will soon --- (apply to: go down, go under, set)

vverb.creationadapt for performance in a different way

Topic:music

Synset:arrange

Examples:

set this poem to music

Derivationally Related Form:arranger

Hypernyms:compose write

Inherited Hypernyms:arrangecomposemake

Direct Hyponyms:prearrangeputtabletabularisetabularizetabulatetranspose

Full Troponyms:prearrangeputtabletranspose

Sentence Frame:Somebody ---s something | Did he --- his major works over a short period of time? (apply to: set, arrange)

vverb.contactput or set (seeds, seedlings, or plants) into the ground

Synset:plant

Examples:

Let's plant flowers in the garden

Derivationally Related Form:plantplantingplanterset

Hypernyms:lay place pose position put set

Inherited Hypernyms:plantputmove

Direct Hyponyms:afforestbedcheckrowdibbleforestpuddlereplantroottree

Full Troponyms:afforestbedcheckrowdibblepuddlere-afforestreforestreplantroottree

Sentence Frame:Somebody ---s something | They --- rye in the field (apply to: plant)

vverb.creationapply or start

Examples:

set fire to a building

Hypernyms:initiate originate start

Inherited Hypernyms:setoriginatemake

Sentence Frame:Somebody ---s something

vverb.changebecome gelatinous

Synset:congeal jell

Examples:

the liquid jelled after we added the enzyme

Derivationally Related Form:setcongelation

Hypernyms:solidify

Inherited Hypernyms:jellsolidifychange integritychange

Sentence Frame:Something ---s

vverb.creationset in type

Synset:typeset

Examples:

My book will be typeset nicely
set these words in italics

Derivationally Related Form:typesetter

Hypernyms:impress print

Inherited Hypernyms:typesetprintwritetracemarkchange

Sentence Frame:Somebody ---s something

vverb.contactput into a position that will restore a normal state

Examples:

set a broken bone

Derivationally Related Form:set

Hypernyms:lay place pose position put set

Inherited Hypernyms:setputmove

Sentence Frame:Somebody ---s something | Did he --- his foot? (apply to: set)

vverb.contactinsert (a nail or screw below the surface, as into a countersink)

Synset:countersink

Derivationally Related Form:countersink

Hypernyms:bury sink

Inherited Hypernyms:setburyimplantinsertattachconnect

Sentence Frame:Somebody ---s something

vverb.contactgive a fine, sharp edge to a knife or razor

Hypernyms:hone

Inherited Hypernyms:sethonesharpenchange

Sentence Frame:Somebody ---s something

vverb.competitionurge to attack someone

Synset:sic

Examples:

The owner sicked his dogs on the intruders
the shaman sics sorcerers on the evil spirits

Hypernyms:assail assault attack set on

Inherited Hypernyms:sicassail

Sentence Frame:Somebody ---s something on somebody

vverb.cognitionestimate

Synset:place put

Examples:

We put the time of arrival at 8 P.M.

Hypernyms:approximate estimate gauge guess judge

Inherited Hypernyms:placeestimatecalculatereasonthink

Sentence Frame:Somebody ---s something

vverb.changeequip with sails or masts

Synset:rig set up

Examples:

rig a ship

Derivationally Related Form:riggerriggingrig

Hypernyms:equip fit fit out outfit

Inherited Hypernyms:rigequipsupplygivetransfer

Sentence Frame:Somebody ---s something

vverb.changeget ready for a particular purpose or event

Synset:lay out set up

Examples:

set up an experiment
set the table
lay out the tools for the surgery

Derivationally Related Form:settingset

Hypernyms:fix gear up prepare ready set set up

Inherited Hypernyms:set upfixchange

Sentence Frame:Somebody ---s something

vverb.changealter or regulate so as to achieve accuracy or conform to a standard

Synset:adjust correct

Examples:

Adjust the clock, please
correct the alignment of the front wheels

Derivationally Related Form:adjustableadjustmentcorrectiveadjustiveadjuster

Hypernyms:alter change modify

Inherited Hypernyms:adjustchange

Direct Hyponyms:alignattunecalibratecitifycoordinatedecompressdepressurisedepressurizefine-tunefitfocalisefocalizefocusgraduateharmoniseharmonizejustifylineariselinearizematchmodulateordinateplumbpressurisepressurizeproportionreadjustreconcileregulateresetsetsharpensyncsynchronisesynchronizetempertimetrimtunetune upzerozero in

Full Troponyms:advancealignattunebalancecalibratecancelcarrycitifycompensatecomplementcounteractcoverdepressurizefine-tunefocusharmonizejustifykeylinearizematchmisalignmodulateoffsetoverridephaseplumbpressurizeproportionpuncturereadjustrefocusregulateresetscale downscale upservicesetsynchronizetempertimetrimtunetune inzero

Sentence Frame:Somebody ---s something | Something ---s something | Somebody ---s something PP

vverb.bodybear fruit

Synset:fructify

Examples:

the apple trees fructify

Derivationally Related Form:fruitfructification

Hypernyms:multiply procreate reproduce

Inherited Hypernyms:fructifyreproducemake

Sentence Frame:Something ---s

vverb.bodyarrange attractively

Synset:arrange coif coiffe coiffure do dress

Examples:

dress my hair for the wedding

Derivationally Related Form:arrangementcoiffure

Hypernyms:groom neaten

Inherited Hypernyms:dressgroomfancifybetterchange

Direct Hyponyms:bobwave

Full Troponyms:bobgauffermarcelpermwave

Sentence Frame:Somebody ---s something | They --- their hair (apply to: set, coiffure, coif, do, dress, arrange, coiffe)

adj satadj.all(usually followed by 'to' or 'for') on the point of or strongly disposed

Synset:fit primed

Examples:

in no fit state to continue
fit to drop
laughing fit to burst
she was fit to scream
primed for a fight
we are set to go at any time

Antonyms:unready

Derivationally Related Form:fitness

Inherited Hypernyms:fit

Similar to:ready

adj satadj.allfixed and unmoving

Synset:fixed rigid

Examples:

with eyes set in a fixed glassy stare
his bearded face already has a set hollow look - Connor Cruise O'Brien
a face rigid with pain

Antonyms:moving

Derivationally Related Form:fixednessrigidnessfixity

Inherited Hypernyms:fixed

Similar to:nonmoving unmoving

adj satadj.allsituated in a particular spot or position

Synset:located placed situated

Examples:

valuable centrally located urban land
strategically placed artillery
a house set on a hilltop
nicely situated on a quiet riverbank

Antonyms:unsettled

Inherited Hypernyms:located

Similar to:settled

adj satadj.allset down according to a plan

Synset:laid

Examples:

a carefully laid table with places set for four people
stones laid in a pattern

Antonyms:disarranged

Inherited Hypernyms:laid

Similar to:arranged ordered

adj satadj.allbeing below the horizon

Examples:

the moon is set

Antonyms:up

Inherited Hypernyms:set

Similar to:down

adj satadj.alldetermined or decided upon as by an authority

Synset:determined dictated

Examples:

date and place are already determined
the dictated terms of surrender
the time set for the launching

Antonyms:unsettled

Inherited Hypernyms:determined

Similar to:settled

adj satadj.allconverted to solid form (as concrete)

Synset:hardened

Antonyms:soft

Inherited Hypernyms:hardened

Similar to:hard

单词	set
释义	Set nnoun.groupa group of things of the same kind that belong together and are so used Examples: a set of books a set of golf clubs a set of teeth Hypernyms:accumulation aggregation assemblage collection Inherited Hypernyms:setcollectiongroupabstractionentity Direct Hyponyms:Cartesian productbracebracketchess setchoirconjugationconsortcorecore groupdentitionfieldintersectionjoinmanicure setnucleusoctetoctettepairportfolioproductquadruplequadrupletquartetquartettequintetquintettequintuplequintupletscoreseptetseptettesestetsextetsextettesingletonsuitesumsynsetteeththreescoretriadtriotripletripletunion Member Meronyms:volume Full Hyponyms: bedroom suitebit fieldbracketcadrechess setchoirconjugationcoredentitiondining-room suitedirect sumfieldincome bracketintersectionlivingroom suitemanicure setoctetpairportfolioprice bracketprimary dentitionquartetquintetscoresecondary dentitionseptetsextetsingletonsuitesynsetthreescoretrilogytriotriplicitytweedledum and tweedledeeunion nnoun.group(mathematics) an abstract collection of numbers or symbols Topic:mathmathematicsmaths Examples: the set of prime numbers is infinite Hypernyms:abstract entity abstraction Inherited Hypernyms:setabstractionentity Direct Hyponyms:Mandelbrot setdiagonaldomaindomain of a functionfieldgroupimageintersectionintervallocusmathematical groupmathematical spacenull setrangerange of a functionrootsolutionsubsettopological spaceuniversal set Full Hyponyms: abelian groupclosed intervaldiagonaldomaineuclidean spacefieldgrouphilbert spaceimageintersectionintervallocusmandelbrot setmanifoldmathematical spacemetric spacenull setnull spaceopen intervaloriginscalar fieldsolutionsub-intervalsubgroupsubsetsubspaceuniversal set nnoun.actseveral exercises intended to be done in series Synset:exercise set Examples: he did four sets of the incline bench press Hypernyms:exercise exercising physical exercise physical exertion workout Inherited Hypernyms:setexerciseeffortlaborworkactivityacteventpsychological featureabstractionentity nnoun.artifactrepresentation consisting of the scenery and other properties used to identify the location of a dramatic production Synset:stage set Examples: the sets were meticulously authentic Part Holonyms:mise en scene setting stage setting Hypernyms:representation Inherited Hypernyms:stage setrepresentationcreationartifactwholeobjectphysical entityentity Direct Hyponyms:scenescenery Part Meronyms:set decoration Full Hyponyms: backdropcoulisseflatmasking piecesceneryset piecetormenter nnoun.groupan unofficial association of people or groups Synset:band circle lot Examples: the smart set goes there they were an angry lot Hypernyms:social group Inherited Hypernyms:setsocial groupgroupabstractionentity Direct Hyponyms:Four Hundredcampcar poolcliquecohortcompanyconfederacyconspiracycoteriehorsey sethorsy setingroupinner circlejet setpackparty Full Hyponyms: bloomsbury groupbohemiacabalcar poolcliquecohortconspiracyfactionfatigue partyfour hundredgalerehard corehard righthorsy setjet setkitchen cabinetlanding partyleftloopmafiamilitary juntaold guardpartyparty to the actionpro-choice factionpro-life factionreligious rightrescue partyrightsearch partysplinter groupstretcher partywar party nnoun.cognitiona relatively permanent inclination to react in a particular way Synset:bent Examples: the set of his mind was obvious Derivationally Related Form:set Hypernyms:disposition inclination tendency Inherited Hypernyms:bentinclinationattitudecognitionpsychological featureabstractionentity nnoun.actthe act of putting something in position Examples: he gave a final set to his hat Derivationally Related Form:set Hypernyms:emplacement locating location placement position positioning Inherited Hypernyms:setplacementactivityacteventpsychological featureabstractionentity nnoun.timea unit of play in tennis or squash Examples: they played two sets of tennis after dinner Hypernyms:period of play play playing period Inherited Hypernyms:setplaying periodmeasureabstractionentity Part Meronyms:game nnoun.processthe process of becoming hard or solid by cooling or drying or crystallization Synset:curing hardening solidification solidifying Examples: the hardening of concrete he tested the set of the glue Derivationally Related Form:hardensolidifysetcure Part Holonyms:plastination Hypernyms:action activity natural action natural process Inherited Hypernyms:hardeningnatural processprocessphysical entityentity Direct Hyponyms:congealmentcongelation Full Hyponyms: congealment nnoun.personevil Egyptian god with the head of a beast that has high square ears and a long snout; brother and murderer of Osiris Synset:Set Seth Instance Hypernyms:Egyptian deity Inherited Hypernyms:setegyptian deitydeityspiritual beingbeliefcontentcognitionpsychological featureabstractionentity nnoun.eventthe descent of a heavenly body below the horizon Examples: before the set of sun Hypernyms:descent Inherited Hypernyms:setdescentchange of locationmovementhappeningeventpsychological featureabstractionentity nnoun.cognition(psychology) being temporarily ready to respond in a particular way Topic:psychological sciencepsychology Synset:readiness Examples: the subjects' set led them to solve problems the familiar way and to overlook the simpler solution his instructions deliberately gave them the wrong set Derivationally Related Form:set Hypernyms:cognitive state state of mind Inherited Hypernyms:setcognitive statepsychological stateconditionstateattributeabstractionentity nnoun.artifactany electronic equipment that receives or transmits radio or tv signals Examples: the early sets ran on storage batteries Part Holonyms:communication equipment communication system Hypernyms:electronic equipment Inherited Hypernyms:setelectronic equipmentequipmentinstrumentalityartifactwholeobjectphysical entityentity Direct Hyponyms:receiverreceiving systemsendertransmitter Full Hyponyms: clock radiocrystal setdirection findergoniometerheterodyne receiverjammerpush-button radioradio compassradio receiverradio transmitterreceiversatellite receiversatellite transmitterspark transmittertelevision receivertelevision transmittertransmitter vverb.contactput into a certain place or abstract location Synset:lay place pose position put Examples: Put your things here Set the tray down Set the dogs on the scent of the missing children Place emphasis on a certain point Derivationally Related Form:placementpositionersetplacepositionsetting Hypernyms:displace move Inherited Hypernyms:putmove Direct Hyponyms:apposearrangebarrelbedbottlebucketbuttclapcockcoffincramdepositdisposedocketemplaceencloseensconcefixglyceroliseglycerolizegroundimbricateincloseinsertinstalinstallintersperseintroducejarjuxtaposeladlelaylay overleanloadmarshalmiddlemisplacenestleparallelizeparkperchpigeonholepilepillowplace downplace uprightplantpoisepositpositionpostposepreposeput backput downput inrack uprecessreclinereplacereposerepositionrestseatseedsetset downset upsettlesettle downshelveshipsignsiphonsitsit downsituatesnugglesowspacestandstand upstepstick instratifysuperimposesuperposeteetee upthrowthrusttrenchunderlayupend Full Troponyms:addressafforestaimalphabetizeapposearrangebarrelbeadbedblowbottlebroadcastbucketburybuttcascadecatenatecatheterizechainchargecheckrowclapcockcodifycoffincollatecompartconcatenateconcordcordcorralcovercramcupdeclaredeploydevelopdibbledigestdisentangledisposedocketdrapedraw a bead ondressemplaceensconceevenfeedfoistgglassglycerolizegradategroundhang upholdhousecleanimbricateinjectinoculateinseminateinsertinsetinstallinterleaveinterlockintersperseinterstratifyjamjarjuxtaposeladlelayleanlevelline uploadmakemarshalmiddlemisplacenestleorderorganizeorientoverstuffpackpadpairparallelizeparkperchpigeonholepilepillowpitchplankplantplayplugpoisepoppositionpostpostposepreenpreposepuddlepyramidrack uprailrangerange inratravelre-afforestrearrangereburyrecessreclinerecodereducereforestregularizereinstallreplacereplantreposerepositionreseatreshipreshufflerestrestructureretrofitrickrootscatterseatsedimentseedserializesetset downsettleshelveshipsightsignsiphonsituateslipsowspacespatspawnspring-cleansquaresquare upstackstaggerstandstemstepstraightenstratifystringstring outstructurestuffsuperimposesuperposeswingsystematizetargetteaseteethrowtidytreetrenchturnunderlayupendwire Sentence Frame:Somebody ---s something PP \| They --- the bags on the table (apply to: pose, set, place, position, put, lay) vverb.cognitionfix conclusively or authoritatively Synset:determine Examples: set the rules Derivationally Related Form:determinationset Inherited Hypernyms:determine Direct Hyponyms:assesschargedatefiliateformatidentifyinitialiseinitializeplacepricetaxvalue Full Troponyms:chargechronologizecloistercontradistinguishcontrastdatedecoupledemarcatedisadvantagediscriminatedistinguishfiliatefloatformatghettoizehandicaphave the distinctionhive offidentifyindividualizeinitializeisolateknowlabellosemark upmaroonmisdateoverpriceovervaluepostdatepredateprejudicepricequarantineredlinerigsecludesegregateseveralizesexstratifysubtilizetaxunderquoteundervaluevalue Sentence Frame:Somebody ---s something \| Somebody ---s to somebody \| Somebody ---s that CLAUSE \| Something ---s something vverb.communicationdecide upon or fix definitely Synset:define determine fix limit specify Examples: fix the variables specify the parameters Derivationally Related Form:determinersetlimitdeterminant Hypernyms:choose pick out select take Inherited Hypernyms:specifychoosedecide Direct Hyponyms:definenamequantifyreset Full Troponyms:definenamequantifyredefinereset Sentence Frame:Somebody ---s something vverb.communicationestablish as the highest level or best performance Synset:mark Examples: set a record Derivationally Related Form:mark Hypernyms:establish lay down make Inherited Hypernyms:setlay downmake Sentence Frame:Somebody ---s something \| Something ---s something vverb.changeput into a certain state; cause to be in a certain state Examples: set the house afire Hypernyms:alter change modify Inherited Hypernyms:setchange Direct Hyponyms:keynotepitch Full Troponyms:keynotepitch Sentence Frame:Something ---s something Adjective/Noun \| Somebody ---s something PP vverb.contactfix in a border Examples: The goldsmith set the diamond Derivationally Related Form:settingset Hypernyms:arrange set up Inherited Hypernyms:setarrangeputmove Sentence Frame:Somebody ---s something vverb.changemake ready or suitable or equip in advance for a particular purpose or for some use, event, etc Synset:fix gear up prepare ready set up Examples: Get the children ready for school! prepare for war I was fixing to leave town after I paid the hotel bill Derivationally Related Form:readyingpreparatorypreparationsetreadypreparative Hypernyms:alter change modify Inherited Hypernyms:fixchange Direct Hyponyms:bracecramcropcultivatefixlay outmountpoisepreconditionprimeprovidesetset upsocialisesocializesummerisesummerizewinterisewinterizework Full Troponyms:bracecramcultivatefixmountovercroppreconditionprimeprovideset upsocializesteelsummerizewinterize Sentence Frame:Somebody ---s somebody PP \| Somebody ---s something PP \| Somebody ---s something \| Somebody ---s somebody \| Something ---s somebody \| Something ---s something \| Somebody ---s to INFINITIVE \| Somebody ---s (apply to: prepare, gear up) vverb.changeset to a certain position or cause to operate correctly Examples: set clocks or instruments Derivationally Related Form:setting Hypernyms:adjust correct set Inherited Hypernyms:setadjustchange Direct Hyponyms:advanceresetset ahead Full Troponyms:advancereset Sentence Frame:Somebody ---s something vverb.creationlocate Synset:localise localize place Examples: The film is set in Africa Derivationally Related Form:setplaceplacementlocalizationlocale Hypernyms:present represent stage Inherited Hypernyms:setstagere-createmake Sentence Frame:Somebody ---s something PP vverb.motiondisappear beyond the horizon Topic:astronomyuranology Synset:go down go under Examples: the sun sets early these days Antonyms:rise Hypernyms:come down descend fall go down Inherited Hypernyms:setdescendtravel Sentence Frame:Something ---s \| The moon will soon --- (apply to: go down, go under, set) vverb.creationadapt for performance in a different way Topic:music Synset:arrange Examples: set this poem to music Derivationally Related Form:arranger Hypernyms:compose write Inherited Hypernyms:arrangecomposemake Direct Hyponyms:prearrangeputtabletabularisetabularizetabulatetranspose Full Troponyms:prearrangeputtabletranspose Sentence Frame:Somebody ---s something \| Did he --- his major works over a short period of time? (apply to: set, arrange) vverb.contactput or set (seeds, seedlings, or plants) into the ground Synset:plant Examples: Let's plant flowers in the garden Derivationally Related Form:plantplantingplanterset Hypernyms:lay place pose position put set Inherited Hypernyms:plantputmove Direct Hyponyms:afforestbedcheckrowdibbleforestpuddlereplantroottree Full Troponyms:afforestbedcheckrowdibblepuddlere-afforestreforestreplantroottree Sentence Frame:Somebody ---s something \| They --- rye in the field (apply to: plant) vverb.creationapply or start Examples: set fire to a building Hypernyms:initiate originate start Inherited Hypernyms:setoriginatemake Sentence Frame:Somebody ---s something vverb.changebecome gelatinous Synset:congeal jell Examples: the liquid jelled after we added the enzyme Derivationally Related Form:setcongelation Hypernyms:solidify Inherited Hypernyms:jellsolidifychange integritychange Sentence Frame:Something ---s vverb.creationset in type Synset:typeset Examples: My book will be typeset nicely set these words in italics Derivationally Related Form:typesetter Hypernyms:impress print Inherited Hypernyms:typesetprintwritetracemarkchange Sentence Frame:Somebody ---s something vverb.contactput into a position that will restore a normal state Examples: set a broken bone Derivationally Related Form:set Hypernyms:lay place pose position put set Inherited Hypernyms:setputmove Sentence Frame:Somebody ---s something \| Did he --- his foot? (apply to: set) vverb.contactinsert (a nail or screw below the surface, as into a countersink) Synset:countersink Derivationally Related Form:countersink Hypernyms:bury sink Inherited Hypernyms:setburyimplantinsertattachconnect Sentence Frame:Somebody ---s something vverb.contactgive a fine, sharp edge to a knife or razor Hypernyms:hone Inherited Hypernyms:sethonesharpenchange Sentence Frame:Somebody ---s something vverb.competitionurge to attack someone Synset:sic Examples: The owner sicked his dogs on the intruders the shaman sics sorcerers on the evil spirits Hypernyms:assail assault attack set on Inherited Hypernyms:sicassail Sentence Frame:Somebody ---s something on somebody vverb.cognitionestimate Synset:place put Examples: We put the time of arrival at 8 P.M. Hypernyms:approximate estimate gauge guess judge Inherited Hypernyms:placeestimatecalculatereasonthink Sentence Frame:Somebody ---s something vverb.changeequip with sails or masts Synset:rig set up Examples: rig a ship Derivationally Related Form:riggerriggingrig Hypernyms:equip fit fit out outfit Inherited Hypernyms:rigequipsupplygivetransfer Sentence Frame:Somebody ---s something vverb.changeget ready for a particular purpose or event Synset:lay out set up Examples: set up an experiment set the table lay out the tools for the surgery Derivationally Related Form:settingset Hypernyms:fix gear up prepare ready set set up Inherited Hypernyms:set upfixchange Sentence Frame:Somebody ---s something vverb.changealter or regulate so as to achieve accuracy or conform to a standard Synset:adjust correct Examples: Adjust the clock, please correct the alignment of the front wheels Derivationally Related Form:adjustableadjustmentcorrectiveadjustiveadjuster Hypernyms:alter change modify Inherited Hypernyms:adjustchange Direct Hyponyms:alignattunecalibratecitifycoordinatedecompressdepressurisedepressurizefine-tunefitfocalisefocalizefocusgraduateharmoniseharmonizejustifylineariselinearizematchmodulateordinateplumbpressurisepressurizeproportionreadjustreconcileregulateresetsetsharpensyncsynchronisesynchronizetempertimetrimtunetune upzerozero in Full Troponyms:advancealignattunebalancecalibratecancelcarrycitifycompensatecomplementcounteractcoverdepressurizefine-tunefocusharmonizejustifykeylinearizematchmisalignmodulateoffsetoverridephaseplumbpressurizeproportionpuncturereadjustrefocusregulateresetscale downscale upservicesetsynchronizetempertimetrimtunetune inzero Sentence Frame:Somebody ---s something \| Something ---s something \| Somebody ---s something PP vverb.bodybear fruit Synset:fructify Examples: the apple trees fructify Derivationally Related Form:fruitfructification Hypernyms:multiply procreate reproduce Inherited Hypernyms:fructifyreproducemake Sentence Frame:Something ---s vverb.bodyarrange attractively Synset:arrange coif coiffe coiffure do dress Examples: dress my hair for the wedding Derivationally Related Form:arrangementcoiffure Hypernyms:groom neaten Inherited Hypernyms:dressgroomfancifybetterchange Direct Hyponyms:bobwave Full Troponyms:bobgauffermarcelpermwave Sentence Frame:Somebody ---s something \| They --- their hair (apply to: set, coiffure, coif, do, dress, arrange, coiffe) adj satadj.all(usually followed by 'to' or 'for') on the point of or strongly disposed Synset:fit primed Examples: in no fit state to continue fit to drop laughing fit to burst she was fit to scream primed for a fight we are set to go at any time Antonyms:unready Derivationally Related Form:fitness Inherited Hypernyms:fit Similar to:ready adj satadj.allfixed and unmoving Synset:fixed rigid Examples: with eyes set in a fixed glassy stare his bearded face already has a set hollow look - Connor Cruise O'Brien a face rigid with pain Antonyms:moving Derivationally Related Form:fixednessrigidnessfixity Inherited Hypernyms:fixed Similar to:nonmoving unmoving adj satadj.allsituated in a particular spot or position Synset:located placed situated Examples: valuable centrally located urban land strategically placed artillery a house set on a hilltop nicely situated on a quiet riverbank Antonyms:unsettled Inherited Hypernyms:located Similar to:settled adj satadj.allset down according to a plan Synset:laid Examples: a carefully laid table with places set for four people stones laid in a pattern Antonyms:disarranged Inherited Hypernyms:laid Similar to:arranged ordered adj satadj.allbeing below the horizon Examples: the moon is set Antonyms:up Inherited Hypernyms:set Similar to:down adj satadj.alldetermined or decided upon as by an authority Synset:determined dictated Examples: date and place are already determined the dictated terms of surrender the time set for the launching Antonyms:unsettled Inherited Hypernyms:determined Similar to:settled adj satadj.allconverted to solid form (as concrete) Synset:hardened Antonyms:soft Inherited Hypernyms:hardened Similar to:hard
随便看	bare-ass bare-assed bareback barebacked bareboat bareboating bare bone bare bones bare-breasted bared barefaced barefacedly barefoot barefooted barehanded bareheaded bare-knuckle bare-knuckled barelegged barely bareness barents sea bar exam bar examination barf