请输入您要查询的英文单词:

 

单词 run
释义
Run
nnoun.acta score in baseball made by a runner touching all four bases safely
Synset:tally
Examples:
  • the Yankees scored 3 runs in the bottom of the 9th
  • their first tally came in the 3rd inning
Derivationally Related Form:runtally
Hypernyms:score
Inherited Hypernyms:runscoresuccessattainmentaccomplishmentactionacteventpsychological featureabstractionentity
Direct Hyponyms:earned runrbirun batted inunearned run
Full Hyponyms:
earned runrun batted inunearned run
nnoun.actthe act of testing something
Synset:test trial
Examples:
  • in the experimental trials the amount of carbon was measured separately
  • he called each flip of the coin a new trial
Derivationally Related Form:testrun
Hypernyms:attempt effort endeavor endeavour try
Inherited Hypernyms:testattemptactivityacteventpsychological featureabstractionentity
Direct Hyponyms:MOTMOT testMinistry of Transportation testSnellen testassayauditionclinical testclinical trialdouble blindfield trialfittingpilot programpilot projectpreclinical phasepreclinical testpreclinical trialtry-ontrying ontryout
Full Hyponyms:
agglutination testassayauditionbioassaybiopsyblood testchorionic villus samplingclinical trialcloze procedurecomplement fixation testdiagnostic testdick testdouble blindenzyme-linked-immunosorbent serologic assayfecal occult testfield trialfittingfriedman testgi seriesglucose tolerance testheterophil testimmunoassayimmunohistochemistryintradermal testmantoux testmotneedle biopsypap testpatch testphase i clinical trialphase ii clinical trialphase iii clinical trialphase iv clinical trialpilot projectpku testpreclinical trialpregnancy testpsa blood testqueckenstedt's testradioactive iodine excretion testradioactive iodine testradioactive iodine uptake testradioimmunoassayrubin testschick testscratch testscreen testskin testsnellen testtine testtissue typingtuberculin testvital capacitywassermann testwidal test
nnoun.eventa race run on foot
Synset:foot race footrace
Examples:
  • she broke the record for the half-mile run
Derivationally Related Form:run
Hypernyms:race
Inherited Hypernyms:footraceracecontestsocial eventeventpsychological featureabstractionentity
Direct Hyponyms:fun runfunrunmarathonobstacle racesteeplechasetrack event
Full Hyponyms:
dashfunrunhurdlesmarathonmileobstacle racesteeplechasetrack event
nnoun.groupan unbroken series of events
Synset:streak
Examples:
  • had a streak of bad luck
  • Nicklaus had a run of birdies
Hypernyms:succession
Inherited Hypernyms:streaksuccessionseriesorderingarrangementgroupabstractionentity
Direct Hyponyms:losing streakwinning streak
Full Hyponyms:
losing streakwinning streak
nnoun.act(American football) a play in which a player attempts to carry the ball through or past the opposing team
Topic:American footballAmerican football game
Synset:running running game running play
Examples:
  • the defensive line braced to stop the run
  • the coach put great emphasis on running
Derivationally Related Form:run
Hypernyms:football play
Inherited Hypernyms:runfootball playplayplan of actionplanideacontentcognitionpsychological featureabstractionentity
Direct Hyponyms:drawdraw playend runreturnreverserushrushingsweep
Full Hyponyms:
double reversedrawend runreturnreverserush
nnoun.acta regular trip
Examples:
  • the ship made its run in record time
Derivationally Related Form:run
Hypernyms:trip
Inherited Hypernyms:runtripjourneytravelmotionchangeactionacteventpsychological featureabstractionentity
nnoun.actthe act of running; traveling on foot at a fast pace
Synset:running
Examples:
  • he broke into a run
  • his daily run keeps him fit
Derivationally Related Form:run
Hypernyms:locomotion travel
Inherited Hypernyms:runlocomotionmotionchangeactionacteventpsychological featureabstractionentity
Direct Hyponyms:dashsprint
Full Hyponyms:
breakdashfast break
nnoun.timethe continuous period of time during which something (a machine or a factory) operates or continues in operation
Examples:
  • the assembly line was on a 12-hour run
Hypernyms:period period of time time period
Inherited Hypernyms:runtime periodfundamental quantitymeasureabstractionentity
Direct Hyponyms:press runprint runrun-time
Full Hyponyms:
print runrun-timesplit run
nnoun.stateunrestricted freedom to use
Examples:
  • he has the run of the house
Derivationally Related Form:run
Hypernyms:liberty
Inherited Hypernyms:runlibertyfreedomstateattributeabstractionentity
nnoun.quantitythe production achieved during a continuous period of operation (of a machine or factory etc.)
Examples:
  • a daily run of 100,000 gallons of paint
Hypernyms:indefinite quantity
Inherited Hypernyms:runindefinite quantitymeasureabstractionentity
nnoun.objecta small stream
Synset:rill rivulet runnel streamlet
Derivationally Related Form:streamrun
Hypernyms:stream watercourse
Inherited Hypernyms:rivuletstreambody of waterthingphysical entityentity
nnoun.eventa race between candidates for elective office
Synset:campaign political campaign
Examples:
  • I managed his campaign for governor
  • he is raising money for a Senate run
Derivationally Related Form:runcampaign
Hypernyms:race
Inherited Hypernyms:political campaignracecontestsocial eventeventpsychological featureabstractionentity
Direct Hyponyms:campaign for governorgovernor's racesenate campaignsenate race
Full Hyponyms:
governor's racesenate campaign
nnoun.eventa row of unravelled stitches
Synset:ladder ravel
Examples:
  • she got a run in her stocking
Derivationally Related Form:ladderravelrun
Hypernyms:damage harm impairment
Inherited Hypernyms:rundamagechangehappeningeventpsychological featureabstractionentity
nnoun.eventthe pouring forth of a fluid
Synset:discharge outpouring
Derivationally Related Form:runrunnydischarge
Hypernyms:flow flowing
Inherited Hypernyms:dischargeflowchange of locationmovementhappeningeventpsychological featureabstractionentity
Direct Hyponyms:escapejetleakleakageoutflowspirtspurtsquirt
Full Hyponyms:
escapejetsprayspritz
nnoun.attributean unbroken chronological sequence
Examples:
  • the play had a long run on Broadway
  • the team enjoyed a brief run of victories
Hypernyms:chronological sequence chronological succession sequence succession successiveness
Inherited Hypernyms:runsequencetemporal arrangementtemporal propertypropertyattributeabstractionentity
nnoun.acta short trip
Examples:
  • take a run into town
Derivationally Related Form:run
Hypernyms:trip
Inherited Hypernyms:runtripjourneytravelmotionchangeactionacteventpsychological featureabstractionentity
vverb.motionmove fast by using one's feet, with one foot off the ground at any given time
Examples:
  • Don't run--you'll be out of breath
  • The children ran to the store
Derivationally Related Form:runningrunnerrun
Hypernyms:hurry speed travel rapidly zip
Inherited Hypernyms:runtravel rapidlytravel
Direct Hyponyms:clipharejoglopeoutrunromprunrun basesrushscamperscurryscuttleskittersprintstreaktrot
Full Troponyms:crabharejoglopeoutrunromprunrun basesrushscurrysprintstreaktrot
Sentence Frame:Something ---s | Somebody ---s | Somebody ---s PP | The horses --- across the field (apply to: run)
vverb.motionflee; take to one's heels; cut and run
Synset:break away bunk escape fly the coop head for the hills hightail it lam run away scarper scat take to the woods turn tail
Examples:
  • If you see this man, run!
  • The burglars escaped before the police showed up
Derivationally Related Form:runawaylam
Hypernyms:go away go forth leave
Inherited Hypernyms:scatleave
Direct Hyponyms:fleeflyskedaddletake flight
Full Troponyms:abscondbreakdefectelopeeludeescapeexfiltratefleehigh-taillevantratrun awayshakeskedaddleslipstampede
Sentence Frame:Something ---s | Somebody ---s | Somebody ---s PP
vverb.stativestretch out over a distance, space, time, or scope; run or extend between two points or beyond a certain point
Synset:extend go lead pass
Examples:
  • Service runs all the way to Cranbury
  • His knowledge doesn't go very far
  • My memory extends back to my fourth year of life
  • The facts extend beyond a consideration of her personal assets
Derivationally Related Form:extent
Hypernyms:be
Inherited Hypernyms:runbe
Direct Hyponyms:comego deepgo farradiaterayunderrun
Full Troponyms:comego farradiateunderrun
Sentence Frame:Something is ---ing PP
vverb.socialdirect or control; projects, businesses, etc.
Synset:operate
Examples:
  • She is running a relief operation in the Sudan
Derivationally Related Form:operatoroperationrunning
Hypernyms:direct
Inherited Hypernyms:operatedirectmanagecontrol
Direct Hyponyms:blockfinancierwarm upwork
Full Troponyms:blockfinancierwarm upwork
Sentence Frame:Somebody ---s something
vverb.stativehave a particular form
Synset:go
Examples:
  • the story or argument runs as follows
  • as the saying goes...
Hypernyms:be
Inherited Hypernyms:runbe
Sentence Frame:Something ---s
vverb.motionmove along, of liquids
Synset:course feed flow
Examples:
  • Water flowed into the cave
  • the Missouri feeds into the Mississippi
Derivationally Related Form:runflowcourseflowing
Hypernyms:move
Inherited Hypernyms:runmove
Direct Hyponyms:circulatedraindribbleeddyfilterflushgushgutterjetoozepourpurlrun downrun offrun outseepspillstreamsurgeswirltidetricklewastewell outwhirlwhirlpool
Full Troponyms:blowcentrifugecirculatedraineddyflushgeysergutterjetleachoverflowpourpumpregurgitaterun downseepspillspinspurtstreamtidetrickleultracentrifugeventilatewash downwastewhoosh
Sentence Frame:Something ---s | Something is ---ing PP | Water and oil --- into the bowl (apply to: flow, run)
vverb.contactperform as expected when applied
Synset:function go operate work
Examples:
  • The washing machine won't go unless it's plugged in
  • Does this old car still run well?
  • This old radio doesn't work anymore
Antonyms:malfunction
Derivationally Related Form:operationoperantoperativefunctioning
Inherited Hypernyms:function
Direct Hyponyms:cutdoublerollrunserveservice
Full Troponyms:cutdoublerollrunservice
Sentence Frame:Something ---s | These cars won't --- (apply to: function, run, operate, go, work)
vverb.stativechange or be different within limits
Synset:range
Examples:
  • Estimates for the losses in the earthquake range as high as $2 billion
  • Interest rates run from 5 to 10 percent
  • The instruments ranged from tuba to cymbals
  • My students range from very bright to dull
Derivationally Related Form:range
Hypernyms:be
Inherited Hypernyms:rangebe
Sentence Frame:Something ---s something
vverb.competitionrun, stand, or compete for an office or a position
Synset:campaign
Examples:
  • Who's running for treasurer this year?
Derivationally Related Form:campaignerruncampaign
Hypernyms:race run
Inherited Hypernyms:campaignracecompete
Direct Hyponyms:cross-fileregisterrerunstumpwhistlestop
Full Troponyms:cross-filererunslatestumpwhistlestop
Sentence Frame:Somebody ---s | Somebody ---s PP
vverb.creationcause to emit recorded audio or video
Synset:play
Examples:
  • They ran the tapes over and over again
  • I'll play you my favorite record
  • He never tires of playing that video
Inherited Hypernyms:play
Sentence Frame:Somebody ---s something | Something ---s something | Sam and Sue --- the movie (apply to: run, play)
vverb.motionmove about freely and without restraint, or act as if running around in an uncontrolled way
Examples:
  • who are these people running around in the building?
  • She runs around telling everyone of her troubles
  • let the dogs run free
Derivationally Related Form:run
Hypernyms:go locomote move travel
Inherited Hypernyms:runtravel
Sentence Frame:Something is ---ing PP | Somebody ---s PP
vverb.stativehave a tendency or disposition to do or be something; be inclined
Synset:be given incline lean tend
Examples:
  • She tends to be nervous before her lectures
  • These dresses run small
  • He inclined to corpulence
Derivationally Related Form:tendencyinclination
Hypernyms:be
Inherited Hypernyms:tendbe
Direct Hyponyms:gravitatesuffertake kindly to
Full Troponyms:gravitatesuffertake kindly to
Sentence Frame:Somebody ---s to INFINITIVE
vverb.contactbe operating, running or functioning
Examples:
  • The car is still running--turn it off!
Antonyms:idle
Derivationally Related Form:running
Hypernyms:function go operate run work
Inherited Hypernyms:runfunction
Sentence Frame:Something ---s
vverb.changechange from one state to another
Examples:
  • run amok
  • run rogue
  • run riot
Hypernyms:become get go
Inherited Hypernyms:runbecomechange statechange
Sentence Frame:Somebody ---s something | Something ---s something | Something ---s Adjective/Noun | Somebody ---s Adjective
vverb.changecause to perform
Examples:
  • run a subject
  • run a process
Hypernyms:process treat
Inherited Hypernyms:runprocessaffectchange
Direct Hyponyms:rerun
Full Troponyms:rerun
Sentence Frame:Somebody ---s something | Somebody ---s somebody
vverb.stativebe affected by; be subjected to
Examples:
  • run a temperature
  • run a risk
Hypernyms:incur
Inherited Hypernyms:runincursubjectaffectchange
Sentence Frame:Somebody ---s something
vverb.stativecontinue to exist
Synset:die hard endure persist prevail
Examples:
  • These stories die hard
  • The legend of Elvis endures
Derivationally Related Form:diehardprevalenceprevalentpersistent
Hypernyms:continue
Inherited Hypernyms:prevailcontinuebe
Direct Hyponyms:carry overreverberate
Full Troponyms:carry overreverberate
Sentence Frame:Something ---s
vverb.stativeoccur persistently
Examples:
  • Musical talent runs in the family
Hypernyms:occur
Inherited Hypernyms:runoccurappear
Sentence Frame:Something is ---ing PP
vverb.socialcarry out a process or program, as on a computer or a machine
Synset:execute
Examples:
  • Run the dishwasher
  • run a new program on the Mac
  • the computer executed the instruction
Derivationally Related Form:executive
Hypernyms:apply enforce implement
Inherited Hypernyms:runenforcecompelinduce
Direct Hyponyms:step
Full Troponyms:step
Sentence Frame:Somebody ---s something | Something ---s something
vverb.creationinclude as the content; broadcast or publicize
Synset:carry
Examples:
  • We ran the ad three times
  • This paper carries a restaurant review
  • All major networks carried the press conference
Hypernyms:broadcast circularise circularize circulate diffuse disperse disseminate distribute pass around propagate spread
Inherited Hypernyms:carrycirculatepublicizetellinformcommunicateinteractact
Sentence Frame:Somebody ---s something | Something ---s something
vverb.creationcarry out
Examples:
  • run an errand
Hypernyms:accomplish action carry out carry through execute fulfil fulfill
Inherited Hypernyms:runcarry throughcompleteendchange
Inherited Hypernyms:runcarry througheffectcausemake
Sentence Frame:Somebody ---s something
vverb.contactpass over, across, or through
Synset:draw guide pass
Examples:
  • He ran his eyes over her body
  • She ran her fingers along the carved figurine
  • He drew her hair through his fingers
Inherited Hypernyms:guide
Direct Hyponyms:rubthread
Full Troponyms:brushdustgaugegrateholystonepawpumicepureeresmudgerosinrubscourscrapescrubsmearspongesponge downsqueegeesweepthreadtowelwhiskwipeworry
Sentence Frame:Somebody ---s something PP
vverb.stativecause something to pass or lead somewhere
Synset:lead
Examples:
  • Run the wire behind the cabinet
Hypernyms:make pass pass
Inherited Hypernyms:runpass
Sentence Frame:Somebody ---s something PP
vverb.socialmake without a miss
Topic:athleticssport
Derivationally Related Form:run
Hypernyms:bring home the bacon come through deliver the goods succeed win
Inherited Hypernyms:runsucceed
Sentence Frame:Somebody ---s something
vverb.possessiondeal in illegally, such as arms or liquor
Topic:crimecriminal offencecriminal offenselaw-breaking
Synset:black market
Derivationally Related Form:runblack market
Hypernyms:merchandise trade
Inherited Hypernyms:runtrade
Sentence Frame:Somebody ---s something
vverb.motioncause an animal to move fast
Examples:
  • run the dogs
Derivationally Related Form:run
Hypernyms:displace move
Inherited Hypernyms:runmove
Sentence Frame:Somebody ---s something | Something ---s something | The men --- the horses across the field (apply to: run)
vverb.motionbe diffused
Synset:bleed
Examples:
  • These dyes and colors are guaranteed not to run
Hypernyms:diffuse fan out spread spread out
Inherited Hypernyms:rundiffusespread
Direct Hyponyms:crock
Full Troponyms:crock
Sentence Frame:Something ---s
vverb.motionsail before the wind
Hypernyms:sail
Inherited Hypernyms:runsailboatridetraveltravel
Sentence Frame:Something ---s | Somebody ---s
vverb.motioncover by running; run a certain distance
Examples:
  • She ran 10 miles that day
Derivationally Related Form:run
Hypernyms:pass
Inherited Hypernyms:runpasstravel
Sentence Frame:Somebody ---s something
vverb.stativeextend or continue for a certain period of time
Synset:run for
Examples:
  • The film runs 5 hours
Hypernyms:endure last
Inherited Hypernyms:runlastmeasurebe
Sentence Frame:Something ---s something
vverb.socialset animals loose to graze
Hypernyms:free liberate loose release unloose unloosen
Inherited Hypernyms:runfree
Sentence Frame:Somebody ---s something
vverb.motionkeep company
Synset:consort
Examples:
  • the heifers run with the bulls to produce offspring
Derivationally Related Form:consort
Hypernyms:accompany
Inherited Hypernyms:runaccompanytravel
Sentence Frame:Something is ---ing PP
vverb.motionrun with the ball; in such sports as football
Topic:athleticssport
Derivationally Related Form:runningrun
Hypernyms:run
Inherited Hypernyms:runruntravel rapidlytravel
Sentence Frame:Somebody ---s
vverb.motiontravel rapidly, by any (unspecified) means
Examples:
  • Run to the store!
  • She always runs to Italy, because she has a lover there
Derivationally Related Form:run
Hypernyms:go locomote move travel
Inherited Hypernyms:runtravel
Sentence Frame:Somebody ---s | Somebody ---s PP
vverb.motiontravel a route regularly
Synset:ply
Examples:
  • Ships ply the waters near the coast
Derivationally Related Form:plierrun
Hypernyms:jaunt travel trip
Inherited Hypernyms:plytravel
Sentence Frame:Something is ---ing PP | Somebody ---s PP
vverb.competitionpursue for food or sport (as of wild animals)
Synset:hunt hunt down track down
Examples:
  • Goering often hunted wild boars in Poland
  • The dogs are running deer
  • The Duke hunted in these woods
Derivationally Related Form:hunthunterhunting
Hypernyms:capture catch
Inherited Hypernyms:huntcaptureget
Direct Hyponyms:ambushcoursedrivefalconferretforagefowlfoxhunthawkjackjacklightpoachrabbitscroungesealsnipestill-huntturtlewhale
Full Troponyms:coursedrivefalconferretfowlfoxhuntgrousehawkjacklightpoachrabbitrustlescroungesealsnipestill-huntturtlewhale
Sentence Frame:Somebody ---s something | Somebody ---s somebody | Somebody ---s | The men --- for animals in the area (apply to: hunt) | The men --- the area for animals (apply to: hunt)
vverb.competitioncompete in a race
Synset:race
Examples:
  • he is running the Marathon this year
  • let's race and see who gets there first
Derivationally Related Form:racingracerracerunningrunnerrun
Hypernyms:compete contend vie
Inherited Hypernyms:racecompete
Direct Hyponyms:boat-racecampaignhorse-raceplacerunshowspeed skate
Full Troponyms:boat-racecampaigncross-filehorse-racejockeyplacererunshowslatespeed skatestumpwhistlestop
Sentence Frame:Somebody ---s | Somebody ---s PP | These cars won't --- (apply to: race, run)
vverb.changeprogress by being changed
Synset:go move
Examples:
  • The speech has to go through several more drafts
  • run through your presentation before the meeting
Derivationally Related Form:run
Hypernyms:change
Inherited Hypernyms:movechange
Sentence Frame:Something is ---ing PP | Somebody ---s PP
vverb.changereduce or cause to be reduced from a solid to a liquid state, usually by heating
Synset:melt melt down
Examples:
  • melt butter
  • melt down gold
  • The wax melted in the sun
Derivationally Related Form:meltmeltablemelting
Hypernyms:break up dissolve resolve
Inherited Hypernyms:meltdissolvechange integritychange
Direct Hyponyms:fuserendertry
Full Troponyms:fusetry
Sentence Frame:Somebody ---s something | Something ---s | Something ---s something
vverb.changecome unraveled or undone as if by snagging
Synset:ladder
Examples:
  • Her nylons were running
Derivationally Related Form:ladderrun
Hypernyms:break come apart fall apart separate split up
Inherited Hypernyms:ladderbreakchange integritychange
Sentence Frame:Something ---s
vverb.changebecome undone
Synset:unravel
Examples:
  • the sweater unraveled
Derivationally Related Form:unravellerrun
Hypernyms:disintegrate
Inherited Hypernyms:rundisintegratechange integritychange
Sentence Frame:Something ---s
随便看

 

英语词典包含147479条英英释义在线翻译词条,基本涵盖了全部常用单词的英英翻译及用法,是英语学习的有利工具。

 

Copyright © 2004-2022 Newdu.com All Rights Reserved
更新时间:2025/7/24 17:37:01